SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2K860 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2K860
Domain Number 1 Region: 360-548
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.37e-65
Family Regulator of G-protein signaling, RGS 0.00000745
Further Details:      
 
Domain Number 2 Region: 757-986
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.07e-65
Family DBL homology domain (DH-domain) 0.000000000978
Further Details:      
 
Domain Number 3 Region: 990-1120
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-38
Family Pleckstrin-homology domain (PH domain) 0.00000127
Further Details:      
 
Domain Number 4 Region: 59-139
Classification Level Classification E-value
Superfamily PDZ domain-like 7.36e-22
Family PDZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G2K860
Sequence length 1532
Comment (tr|A0A0G2K860|A0A0G2K860_RAT) Rho guanine nucleotide exchange factor 12 {ECO:0000313|Ensembl:ENSRNOP00000074482} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Arhgef12 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
RFPLKKPIRHGSILNRESPTDKKQKVERSTSHDFDPTDSSSKKTKSSSEESRSEIYGLVQ
RCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGTLVTHSNHLEV
VKLIRSGSYVALTVQGRPPGSPQIPLAESEVEPSVIGHMSPIMTSPHSPGAAGNMERITS
PVLMGEENNVVHNQKVEILRKMLQKEQERLQLLQEDYNRTATQRLLKEIQEAKKHIPQLQ
EQLSKATGSAQDGAVIAPSRPLGDALTLSEAETDPGDGLCRTDWSSGDASRPSSDSADSP
KSSLKERVCLEDTPERTEGVQDADTQSLVGSPSTRGAPHIIGAEDDDFGTEHEQINGQCS
CFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKQTNSKETRRVFLEFHQFFL
DRSAHLRVSVPEEISVDLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHLEDFRQKRSMG
LTLAESELTKLDAERDKDRGTLEKERACAEQIVTKIEEVLMTAQAVEEERSSTMQYVILM
YMKHLGVKVKEPRNLEHKRGRIGFLPKIKQSMKKDREGEEKGKRRGFPSILGPPRRPSRH
DNSAIGRAMEIQKLRHPKHLSAPSSMSPELQDPAKLRQSGVANEGTDTGYLPASSMSSAT
SGAALSQEGGRENDTGAKQVGDAVAPGDCLDSIPRVPNTVFDFPPPLLDQVQEEECEVER
VAEHGTPKPFRKFDSIAFGESQSEDEQFENDLETDPPNWQQLVSREVLLGLKPSEIKRQE
VINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQLHVGLNEQMK
AVRKRNETSVIDHIGEDLLLWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQT
FVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPPEREKVKKAADQCRQI
LNYVNQAVREAENKQRLEDYQRRLDTSSLKLSEYPNVDELRNLDLTKRKMIHEGPLVWKV
NRDKSIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVIKLSTVLVRQV
ATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSTKPIPLPQPPPC
EGDNDEEEPAKLKVEHHDLSVAGLQSPDRVLGLESPLISSKPQSHSMNTPGKSEAEHLFV
TATQFAKEQHANGTFKEGDGGYPVTISDPHLPVSEERWALDALRNLGLLKQLLVQQLGLT
EKTTQEDWRSFSRYRPASEEAQADSGIPDLESVKACHAGEGQMSFKTGTGDVATCDSPRT
STESCAVQDSVILASQDSQASNIIEMDHMLLTPEVPTTAEPEGGLDDSGEHFFDAREAHS
DDNPSEGDGAVRKEEEDVNVRISGNCLXLDGYDAAGELPTDEEICFPHITRGPSLLVALP
SHHSHNSPFQNAFSGRFPPSTPEFLFQRRWESCEHCREKLIPVAFVTKTLKIYYFHAISS
DHKHLQKVEESYTLLCQRLAGSALPDKVSDKS
Download sequence
Identical sequences A0A0G2K860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]