SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2KHK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2KHK8
Domain Number 1 Region: 149-201
Classification Level Classification E-value
Superfamily Hsp90 co-chaperone CDC37 2.22e-17
Family Hsp90 co-chaperone CDC37 0.0000677
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G2KHK8
Sequence length 201
Comment (tr|A0A0G2KHK8|A0A0G2KHK8_DANRE) Cell division cycle 37 {ECO:0000313|Ensembl:ENSDARP00000131796} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN= OC=Cyprinidae; Danio.
Sequence
MTTIDYSVWDHIEVSDDEDDTHPNIDTPSLFRWRHQARVERMEAFTQKGVELEKSLMESR
RRLAEAQRRVQELSSSSSSTELSRAQAEEKQLKKEERSLQRKMEEHRAEEKKMPWNVDTL
SREGFSKSVVNVKPEQKQETEEEKEEKHKTFVEKHEKQIKHFGMLRRWDDSQKYLSDNPH
LVCEETANYLVIMCIDLEVEE
Download sequence
Identical sequences A0A0G2KHK8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]