SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2NP12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0G2NP12
Domain Number - Region: 2-84
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00392
Family Pseudo ankyrin repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G2NP12
Sequence length 89
Comment (tr|A0A0G2NP12|A0A0G2NP12_SALGL) Uncharacterized protein {ECO:0000313|EMBL:EGE34570.1} KW=Complete proteome OX=909947 OS=Salmonella enterica subsp. enterica serovar Gallinarum str. SG9. GN=SG9_2044 OC=Enterobacteriaceae; Salmonella.
Sequence
MNNIKMITLFHPHDKTPFMICIVSKVEDTEHGLKLTLENGNNICVNNYSHYLLSDSVSRC
DKDRLKNIYIRLVSELTQMSEETIKSQML
Download sequence
Identical sequences A0A0G2NP12 A0A1R2I8G6 A0A2I8I8R5 A0A2J0RNY5 B5RBI4 M7RXA7 S4KBN7
550537.SEN1988 550538.SG2015 gi|378954651|ref|YP_005212138.1| gi|205353144|ref|YP_002226945.1| gi|207857430|ref|YP_002244081.1| gi|529222091|ref|YP_008380355.1| WP_001059614.1.100017 WP_001059614.1.100077 WP_001059614.1.100149 WP_001059614.1.100191 WP_001059614.1.100392 WP_001059614.1.100412 WP_001059614.1.100457 WP_001059614.1.100519 WP_001059614.1.100541 WP_001059614.1.100557 WP_001059614.1.100605 WP_001059614.1.100776 WP_001059614.1.10081 WP_001059614.1.100857 WP_001059614.1.100895 WP_001059614.1.101112 WP_001059614.1.101541 WP_001059614.1.101634 WP_001059614.1.101674 WP_001059614.1.101832 WP_001059614.1.101917 WP_001059614.1.101927 WP_001059614.1.102111 WP_001059614.1.10300 WP_001059614.1.10498 WP_001059614.1.10631 WP_001059614.1.10755 WP_001059614.1.10868 WP_001059614.1.10898 WP_001059614.1.11119 WP_001059614.1.11216 WP_001059614.1.1150 WP_001059614.1.11526 WP_001059614.1.11528 WP_001059614.1.1156 WP_001059614.1.1169 WP_001059614.1.1174 WP_001059614.1.11824 WP_001059614.1.11841 WP_001059614.1.11900 WP_001059614.1.11978 WP_001059614.1.12027 WP_001059614.1.12106 WP_001059614.1.1215 WP_001059614.1.12168 WP_001059614.1.12340 WP_001059614.1.12374 WP_001059614.1.1239 WP_001059614.1.12485 WP_001059614.1.12568 WP_001059614.1.12569 WP_001059614.1.12585 WP_001059614.1.12696 WP_001059614.1.1300 WP_001059614.1.13076 WP_001059614.1.13102 WP_001059614.1.13247 WP_001059614.1.13274 WP_001059614.1.13367 WP_001059614.1.13391 WP_001059614.1.1346 WP_001059614.1.13573 WP_001059614.1.13625 WP_001059614.1.1412 WP_001059614.1.146 WP_001059614.1.14708 WP_001059614.1.14793 WP_001059614.1.14819 WP_001059614.1.14913 WP_001059614.1.15067 WP_001059614.1.15276 WP_001059614.1.15318 WP_001059614.1.15585 WP_001059614.1.1568 WP_001059614.1.15775 WP_001059614.1.15777 WP_001059614.1.16363 WP_001059614.1.16365 WP_001059614.1.16366 WP_001059614.1.16394 WP_001059614.1.16474 WP_001059614.1.16729 WP_001059614.1.16972 WP_001059614.1.17060 WP_001059614.1.17096 WP_001059614.1.17105 WP_001059614.1.1733 WP_001059614.1.17482 WP_001059614.1.17525 WP_001059614.1.17583 WP_001059614.1.17732 WP_001059614.1.17886 WP_001059614.1.17914 WP_001059614.1.17936 WP_001059614.1.18056 WP_001059614.1.18061 WP_001059614.1.18092 WP_001059614.1.18109 WP_001059614.1.18149 WP_001059614.1.18384 WP_001059614.1.18641 WP_001059614.1.18686 WP_001059614.1.18737 WP_001059614.1.18847 WP_001059614.1.18886 WP_001059614.1.1895 WP_001059614.1.19093 WP_001059614.1.19433 WP_001059614.1.1955 WP_001059614.1.19656 WP_001059614.1.19834 WP_001059614.1.19938 WP_001059614.1.20086 WP_001059614.1.20261 WP_001059614.1.2041 WP_001059614.1.20437 WP_001059614.1.2047 WP_001059614.1.20767 WP_001059614.1.2107 WP_001059614.1.21079 WP_001059614.1.21103 WP_001059614.1.2116 WP_001059614.1.21194 WP_001059614.1.21202 WP_001059614.1.21241 WP_001059614.1.21332 WP_001059614.1.21616 WP_001059614.1.21681 WP_001059614.1.21715 WP_001059614.1.21909 WP_001059614.1.21950 WP_001059614.1.22051 WP_001059614.1.22096 WP_001059614.1.22136 WP_001059614.1.22158 WP_001059614.1.22162 WP_001059614.1.22296 WP_001059614.1.22346 WP_001059614.1.22449 WP_001059614.1.22454 WP_001059614.1.22460 WP_001059614.1.22590 WP_001059614.1.22595 WP_001059614.1.22605 WP_001059614.1.22760 WP_001059614.1.22857 WP_001059614.1.22880 WP_001059614.1.22902 WP_001059614.1.22947 WP_001059614.1.2324 WP_001059614.1.23329 WP_001059614.1.23442 WP_001059614.1.2358 WP_001059614.1.23631 WP_001059614.1.23746 WP_001059614.1.24145 WP_001059614.1.24214 WP_001059614.1.24250 WP_001059614.1.24297 WP_001059614.1.24361 WP_001059614.1.24408 WP_001059614.1.24409 WP_001059614.1.24476 WP_001059614.1.24494 WP_001059614.1.24673 WP_001059614.1.24803 WP_001059614.1.24901 WP_001059614.1.24944 WP_001059614.1.25159 WP_001059614.1.25175 WP_001059614.1.25354 WP_001059614.1.25421 WP_001059614.1.25426 WP_001059614.1.25618 WP_001059614.1.2568 WP_001059614.1.25709 WP_001059614.1.25780 WP_001059614.1.25951 WP_001059614.1.26083 WP_001059614.1.26194 WP_001059614.1.26441 WP_001059614.1.26532 WP_001059614.1.26587 WP_001059614.1.26687 WP_001059614.1.2672 WP_001059614.1.26794 WP_001059614.1.26936 WP_001059614.1.27272 WP_001059614.1.27314 WP_001059614.1.27383 WP_001059614.1.27547 WP_001059614.1.27632 WP_001059614.1.27638 WP_001059614.1.27658 WP_001059614.1.27800 WP_001059614.1.27833 WP_001059614.1.27883 WP_001059614.1.27995 WP_001059614.1.28037 WP_001059614.1.28056 WP_001059614.1.28139 WP_001059614.1.28200 WP_001059614.1.28232 WP_001059614.1.28233 WP_001059614.1.28303 WP_001059614.1.28462 WP_001059614.1.2853 WP_001059614.1.28570 WP_001059614.1.28620 WP_001059614.1.28733 WP_001059614.1.28773 WP_001059614.1.29168 WP_001059614.1.29218 WP_001059614.1.2924 WP_001059614.1.29274 WP_001059614.1.2932 WP_001059614.1.29379 WP_001059614.1.29422 WP_001059614.1.29436 WP_001059614.1.29576 WP_001059614.1.29711 WP_001059614.1.3005 WP_001059614.1.30059 WP_001059614.1.30165 WP_001059614.1.30210 WP_001059614.1.30278 WP_001059614.1.30492 WP_001059614.1.30548 WP_001059614.1.30589 WP_001059614.1.30627 WP_001059614.1.3067 WP_001059614.1.30752 WP_001059614.1.30968 WP_001059614.1.31167 WP_001059614.1.31272 WP_001059614.1.31335 WP_001059614.1.31435 WP_001059614.1.31585 WP_001059614.1.3167 WP_001059614.1.31895 WP_001059614.1.31901 WP_001059614.1.31983 WP_001059614.1.32109 WP_001059614.1.32252 WP_001059614.1.32255 WP_001059614.1.32274 WP_001059614.1.32309 WP_001059614.1.32519 WP_001059614.1.32668 WP_001059614.1.32740 WP_001059614.1.32832 WP_001059614.1.32881 WP_001059614.1.32899 WP_001059614.1.32977 WP_001059614.1.33253 WP_001059614.1.33270 WP_001059614.1.33409 WP_001059614.1.335 WP_001059614.1.3356 WP_001059614.1.33586 WP_001059614.1.3364 WP_001059614.1.33865 WP_001059614.1.3396 WP_001059614.1.34 WP_001059614.1.34091 WP_001059614.1.34185 WP_001059614.1.34292 WP_001059614.1.3438 WP_001059614.1.34431 WP_001059614.1.34454 WP_001059614.1.34614 WP_001059614.1.34684 WP_001059614.1.34711 WP_001059614.1.34820 WP_001059614.1.35219 WP_001059614.1.35298 WP_001059614.1.35321 WP_001059614.1.35332 WP_001059614.1.35563 WP_001059614.1.35594 WP_001059614.1.35619 WP_001059614.1.35624 WP_001059614.1.3572 WP_001059614.1.35887 WP_001059614.1.35936 WP_001059614.1.35961 WP_001059614.1.36037 WP_001059614.1.36063 WP_001059614.1.36409 WP_001059614.1.36445 WP_001059614.1.36584 WP_001059614.1.36685 WP_001059614.1.36721 WP_001059614.1.36764 WP_001059614.1.36889 WP_001059614.1.37029 WP_001059614.1.37114 WP_001059614.1.37191 WP_001059614.1.3726 WP_001059614.1.37297 WP_001059614.1.37405 WP_001059614.1.3748 WP_001059614.1.3771 WP_001059614.1.3778 WP_001059614.1.37864 WP_001059614.1.3790 WP_001059614.1.38037 WP_001059614.1.38047 WP_001059614.1.38344 WP_001059614.1.39048 WP_001059614.1.39055 WP_001059614.1.39065 WP_001059614.1.39312 WP_001059614.1.39395 WP_001059614.1.39414 WP_001059614.1.39614 WP_001059614.1.40081 WP_001059614.1.40158 WP_001059614.1.40284 WP_001059614.1.40307 WP_001059614.1.40493 WP_001059614.1.40533 WP_001059614.1.40577 WP_001059614.1.40622 WP_001059614.1.40695 WP_001059614.1.40745 WP_001059614.1.40849 WP_001059614.1.40930 WP_001059614.1.40973 WP_001059614.1.41116 WP_001059614.1.41128 WP_001059614.1.41192 WP_001059614.1.41277 WP_001059614.1.4141 WP_001059614.1.41427 WP_001059614.1.41434 WP_001059614.1.41528 WP_001059614.1.41610 WP_001059614.1.41690 WP_001059614.1.41799 WP_001059614.1.41802 WP_001059614.1.41911 WP_001059614.1.41949 WP_001059614.1.41978 WP_001059614.1.42136 WP_001059614.1.422 WP_001059614.1.42263 WP_001059614.1.42322 WP_001059614.1.42392 WP_001059614.1.42595 WP_001059614.1.42666 WP_001059614.1.42683 WP_001059614.1.42734 WP_001059614.1.42892 WP_001059614.1.42932 WP_001059614.1.43201 WP_001059614.1.4344 WP_001059614.1.43685 WP_001059614.1.43711 WP_001059614.1.43785 WP_001059614.1.44010 WP_001059614.1.44187 WP_001059614.1.44337 WP_001059614.1.44397 WP_001059614.1.44474 WP_001059614.1.44705 WP_001059614.1.44831 WP_001059614.1.44966 WP_001059614.1.44978 WP_001059614.1.44997 WP_001059614.1.4500 WP_001059614.1.45173 WP_001059614.1.45302 WP_001059614.1.4531 WP_001059614.1.45432 WP_001059614.1.45549 WP_001059614.1.45569 WP_001059614.1.45571 WP_001059614.1.45583 WP_001059614.1.45706 WP_001059614.1.45844 WP_001059614.1.45906 WP_001059614.1.45918 WP_001059614.1.4592 WP_001059614.1.46215 WP_001059614.1.46578 WP_001059614.1.46726 WP_001059614.1.4674 WP_001059614.1.4686 WP_001059614.1.46967 WP_001059614.1.46976 WP_001059614.1.47507 WP_001059614.1.47567 WP_001059614.1.47576 WP_001059614.1.4758 WP_001059614.1.47829 WP_001059614.1.47850 WP_001059614.1.47875 WP_001059614.1.47911 WP_001059614.1.47988 WP_001059614.1.48268 WP_001059614.1.4839 WP_001059614.1.48797 WP_001059614.1.49311 WP_001059614.1.49334 WP_001059614.1.49770 WP_001059614.1.50128 WP_001059614.1.50332 WP_001059614.1.50449 WP_001059614.1.50652 WP_001059614.1.50684 WP_001059614.1.50882 WP_001059614.1.50905 WP_001059614.1.50960 WP_001059614.1.51356 WP_001059614.1.51412 WP_001059614.1.51451 WP_001059614.1.51502 WP_001059614.1.51518 WP_001059614.1.51642 WP_001059614.1.51810 WP_001059614.1.51868 WP_001059614.1.51930 WP_001059614.1.51994 WP_001059614.1.520 WP_001059614.1.5211 WP_001059614.1.52301 WP_001059614.1.52321 WP_001059614.1.52582 WP_001059614.1.52586 WP_001059614.1.52833 WP_001059614.1.53107 WP_001059614.1.53119 WP_001059614.1.5313 WP_001059614.1.53234 WP_001059614.1.53362 WP_001059614.1.53385 WP_001059614.1.53567 WP_001059614.1.53664 WP_001059614.1.53778 WP_001059614.1.53781 WP_001059614.1.53896 WP_001059614.1.53961 WP_001059614.1.54068 WP_001059614.1.54283 WP_001059614.1.54366 WP_001059614.1.54469 WP_001059614.1.54615 WP_001059614.1.54833 WP_001059614.1.54877 WP_001059614.1.54936 WP_001059614.1.55559 WP_001059614.1.55640 WP_001059614.1.5572 WP_001059614.1.5577 WP_001059614.1.55853 WP_001059614.1.55923 WP_001059614.1.55948 WP_001059614.1.56235 WP_001059614.1.56263 WP_001059614.1.5668 WP_001059614.1.56851 WP_001059614.1.56861 WP_001059614.1.56898 WP_001059614.1.56950 WP_001059614.1.57026 WP_001059614.1.57039 WP_001059614.1.57056 WP_001059614.1.5711 WP_001059614.1.57143 WP_001059614.1.57246 WP_001059614.1.57296 WP_001059614.1.57362 WP_001059614.1.57559 WP_001059614.1.57631 WP_001059614.1.5774 WP_001059614.1.57835 WP_001059614.1.57893 WP_001059614.1.58090 WP_001059614.1.5828 WP_001059614.1.58290 WP_001059614.1.58443 WP_001059614.1.58486 WP_001059614.1.58675 WP_001059614.1.587 WP_001059614.1.58749 WP_001059614.1.58884 WP_001059614.1.58926 WP_001059614.1.59142 WP_001059614.1.59163 WP_001059614.1.59335 WP_001059614.1.59538 WP_001059614.1.59548 WP_001059614.1.59646 WP_001059614.1.59848 WP_001059614.1.60126 WP_001059614.1.60137 WP_001059614.1.60320 WP_001059614.1.6033 WP_001059614.1.60425 WP_001059614.1.60560 WP_001059614.1.60713 WP_001059614.1.608 WP_001059614.1.60866 WP_001059614.1.60897 WP_001059614.1.61356 WP_001059614.1.61381 WP_001059614.1.61501 WP_001059614.1.61594 WP_001059614.1.61595 WP_001059614.1.61671 WP_001059614.1.61908 WP_001059614.1.62158 WP_001059614.1.62201 WP_001059614.1.62210 WP_001059614.1.62245 WP_001059614.1.62412 WP_001059614.1.627 WP_001059614.1.62745 WP_001059614.1.62757 WP_001059614.1.6292 WP_001059614.1.62983 WP_001059614.1.62988 WP_001059614.1.63045 WP_001059614.1.63102 WP_001059614.1.63229 WP_001059614.1.63358 WP_001059614.1.63497 WP_001059614.1.63509 WP_001059614.1.63529 WP_001059614.1.63585 WP_001059614.1.63603 WP_001059614.1.6370 WP_001059614.1.63748 WP_001059614.1.63851 WP_001059614.1.63863 WP_001059614.1.64010 WP_001059614.1.64085 WP_001059614.1.64109 WP_001059614.1.64121 WP_001059614.1.64157 WP_001059614.1.64229 WP_001059614.1.64350 WP_001059614.1.64385 WP_001059614.1.64462 WP_001059614.1.64500 WP_001059614.1.64597 WP_001059614.1.64711 WP_001059614.1.65011 WP_001059614.1.65357 WP_001059614.1.65601 WP_001059614.1.65771 WP_001059614.1.65881 WP_001059614.1.65883 WP_001059614.1.65901 WP_001059614.1.6595 WP_001059614.1.66122 WP_001059614.1.66171 WP_001059614.1.66289 WP_001059614.1.66315 WP_001059614.1.66385 WP_001059614.1.66400 WP_001059614.1.66428 WP_001059614.1.66446 WP_001059614.1.66539 WP_001059614.1.66733 WP_001059614.1.66937 WP_001059614.1.66959 WP_001059614.1.67075 WP_001059614.1.6710 WP_001059614.1.67173 WP_001059614.1.67279 WP_001059614.1.6760 WP_001059614.1.6782 WP_001059614.1.67932 WP_001059614.1.68140 WP_001059614.1.68159 WP_001059614.1.68652 WP_001059614.1.68677 WP_001059614.1.68893 WP_001059614.1.68895 WP_001059614.1.69080 WP_001059614.1.69086 WP_001059614.1.69131 WP_001059614.1.69236 WP_001059614.1.69273 WP_001059614.1.69357 WP_001059614.1.69485 WP_001059614.1.69575 WP_001059614.1.69616 WP_001059614.1.69767 WP_001059614.1.69965 WP_001059614.1.70088 WP_001059614.1.70272 WP_001059614.1.70303 WP_001059614.1.70440 WP_001059614.1.70531 WP_001059614.1.70596 WP_001059614.1.70678 WP_001059614.1.70785 WP_001059614.1.70837 WP_001059614.1.70929 WP_001059614.1.70977 WP_001059614.1.71172 WP_001059614.1.71184 WP_001059614.1.71201 WP_001059614.1.71305 WP_001059614.1.71600 WP_001059614.1.71626 WP_001059614.1.71649 WP_001059614.1.71984 WP_001059614.1.720 WP_001059614.1.72100 WP_001059614.1.72182 WP_001059614.1.72190 WP_001059614.1.72221 WP_001059614.1.72300 WP_001059614.1.72325 WP_001059614.1.72339 WP_001059614.1.72470 WP_001059614.1.72532 WP_001059614.1.72602 WP_001059614.1.72625 WP_001059614.1.72716 WP_001059614.1.72718 WP_001059614.1.72865 WP_001059614.1.7295 WP_001059614.1.73068 WP_001059614.1.73708 WP_001059614.1.73764 WP_001059614.1.74207 WP_001059614.1.743 WP_001059614.1.74300 WP_001059614.1.74578 WP_001059614.1.74972 WP_001059614.1.75051 WP_001059614.1.75056 WP_001059614.1.75148 WP_001059614.1.75159 WP_001059614.1.75400 WP_001059614.1.75450 WP_001059614.1.7558 WP_001059614.1.75607 WP_001059614.1.75716 WP_001059614.1.75751 WP_001059614.1.75794 WP_001059614.1.75810 WP_001059614.1.75863 WP_001059614.1.75902 WP_001059614.1.76108 WP_001059614.1.76137 WP_001059614.1.76345 WP_001059614.1.76451 WP_001059614.1.76495 WP_001059614.1.76776 WP_001059614.1.76913 WP_001059614.1.76968 WP_001059614.1.77067 WP_001059614.1.77306 WP_001059614.1.77356 WP_001059614.1.77475 WP_001059614.1.77496 WP_001059614.1.7792 WP_001059614.1.7793 WP_001059614.1.77951 WP_001059614.1.77983 WP_001059614.1.77989 WP_001059614.1.7802 WP_001059614.1.78051 WP_001059614.1.78501 WP_001059614.1.78603 WP_001059614.1.78632 WP_001059614.1.78658 WP_001059614.1.78697 WP_001059614.1.78734 WP_001059614.1.7877 WP_001059614.1.78815 WP_001059614.1.78877 WP_001059614.1.78896 WP_001059614.1.79099 WP_001059614.1.79289 WP_001059614.1.79468 WP_001059614.1.79580 WP_001059614.1.79586 WP_001059614.1.79757 WP_001059614.1.7982 WP_001059614.1.7991 WP_001059614.1.79910 WP_001059614.1.80249 WP_001059614.1.80254 WP_001059614.1.80380 WP_001059614.1.80609 WP_001059614.1.80760 WP_001059614.1.80874 WP_001059614.1.80876 WP_001059614.1.8106 WP_001059614.1.81109 WP_001059614.1.81110 WP_001059614.1.81197 WP_001059614.1.81225 WP_001059614.1.8130 WP_001059614.1.8134 WP_001059614.1.81388 WP_001059614.1.81455 WP_001059614.1.81668 WP_001059614.1.81768 WP_001059614.1.82149 WP_001059614.1.82401 WP_001059614.1.82420 WP_001059614.1.82434 WP_001059614.1.8247 WP_001059614.1.82474 WP_001059614.1.82569 WP_001059614.1.83005 WP_001059614.1.83006 WP_001059614.1.83204 WP_001059614.1.83331 WP_001059614.1.83354 WP_001059614.1.83356 WP_001059614.1.83558 WP_001059614.1.8399 WP_001059614.1.84000 WP_001059614.1.84011 WP_001059614.1.84075 WP_001059614.1.84083 WP_001059614.1.84086 WP_001059614.1.84154 WP_001059614.1.8425 WP_001059614.1.84300 WP_001059614.1.84497 WP_001059614.1.84515 WP_001059614.1.84572 WP_001059614.1.84598 WP_001059614.1.84876 WP_001059614.1.84983 WP_001059614.1.85079 WP_001059614.1.8526 WP_001059614.1.85271 WP_001059614.1.85301 WP_001059614.1.85759 WP_001059614.1.86138 WP_001059614.1.86157 WP_001059614.1.86159 WP_001059614.1.8616 WP_001059614.1.86240 WP_001059614.1.86347 WP_001059614.1.86380 WP_001059614.1.8647 WP_001059614.1.86514 WP_001059614.1.86610 WP_001059614.1.86915 WP_001059614.1.87038 WP_001059614.1.87187 WP_001059614.1.87265 WP_001059614.1.87484 WP_001059614.1.87500 WP_001059614.1.87583 WP_001059614.1.87712 WP_001059614.1.87760 WP_001059614.1.87905 WP_001059614.1.87936 WP_001059614.1.88052 WP_001059614.1.88185 WP_001059614.1.88275 WP_001059614.1.88356 WP_001059614.1.88474 WP_001059614.1.88731 WP_001059614.1.88854 WP_001059614.1.88966 WP_001059614.1.88968 WP_001059614.1.88982 WP_001059614.1.88998 WP_001059614.1.89120 WP_001059614.1.89177 WP_001059614.1.89221 WP_001059614.1.89362 WP_001059614.1.89408 WP_001059614.1.89425 WP_001059614.1.89606 WP_001059614.1.8961 WP_001059614.1.89680 WP_001059614.1.89832 WP_001059614.1.9003 WP_001059614.1.90421 WP_001059614.1.90522 WP_001059614.1.90540 WP_001059614.1.90563 WP_001059614.1.90748 WP_001059614.1.90759 WP_001059614.1.90859 WP_001059614.1.90959 WP_001059614.1.90973 WP_001059614.1.90983 WP_001059614.1.91215 WP_001059614.1.9137 WP_001059614.1.91372 WP_001059614.1.91424 WP_001059614.1.91474 WP_001059614.1.91505 WP_001059614.1.91742 WP_001059614.1.91772 WP_001059614.1.91776 WP_001059614.1.91795 WP_001059614.1.91898 WP_001059614.1.91904 WP_001059614.1.91974 WP_001059614.1.92082 WP_001059614.1.92129 WP_001059614.1.9222 WP_001059614.1.92452 WP_001059614.1.92557 WP_001059614.1.92628 WP_001059614.1.92754 WP_001059614.1.92806 WP_001059614.1.92890 WP_001059614.1.92929 WP_001059614.1.93076 WP_001059614.1.93215 WP_001059614.1.93350 WP_001059614.1.93410 WP_001059614.1.93577 WP_001059614.1.9380 WP_001059614.1.93809 WP_001059614.1.9440 WP_001059614.1.94473 WP_001059614.1.94598 WP_001059614.1.94649 WP_001059614.1.94670 WP_001059614.1.94835 WP_001059614.1.94983 WP_001059614.1.95136 WP_001059614.1.9527 WP_001059614.1.95434 WP_001059614.1.95447 WP_001059614.1.95456 WP_001059614.1.95558 WP_001059614.1.95607 WP_001059614.1.95656 WP_001059614.1.95757 WP_001059614.1.9586 WP_001059614.1.95866 WP_001059614.1.95963 WP_001059614.1.96107 WP_001059614.1.9624 WP_001059614.1.96340 WP_001059614.1.96348 WP_001059614.1.96349 WP_001059614.1.96380 WP_001059614.1.96490 WP_001059614.1.96521 WP_001059614.1.96537 WP_001059614.1.96584 WP_001059614.1.96735 WP_001059614.1.96876 WP_001059614.1.96993 WP_001059614.1.97103 WP_001059614.1.97322 WP_001059614.1.97328 WP_001059614.1.97547 WP_001059614.1.97648 WP_001059614.1.97656 WP_001059614.1.97704 WP_001059614.1.9774 WP_001059614.1.9793 WP_001059614.1.97981 WP_001059614.1.97991 WP_001059614.1.98119 WP_001059614.1.98338 WP_001059614.1.98440 WP_001059614.1.98472 WP_001059614.1.98570 WP_001059614.1.98726 WP_001059614.1.9899 WP_001059614.1.99057 WP_001059614.1.99097 WP_001059614.1.99164 WP_001059614.1.99215 WP_001059614.1.99456 WP_001059614.1.99490 WP_001059614.1.99493 WP_001059614.1.99577 WP_001059614.1.99613 WP_001059614.1.99630 WP_001059614.1.99924 WP_001059614.1.99961 AM933172|CDS_2078727-2078458 AM933173|CDS_2069855-2069586 gi|537436220|ref|YP_008480597.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]