SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2TPP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2TPP6
Domain Number 1 Region: 23-77
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000228
Family TNF receptor-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G2TPP6
Sequence length 175
Comment (tr|A0A0G2TPP6|A0A0G2TPP6_HCMV) Membrane glycoprotein UL144 {ECO:0000313|EMBL:AKI15031.1} KW=Complete proteome OX=10359 OS=Human cytomegalovirus (HHV-5) (Human herpesvirus 5). GN=UL144 OC=Betaherpesvirinae; Cytomegalovirus. OH=9606
Sequence
MKPLVMLICFHVFLLQLGGSKMCKPDEVKLGNQCCPPCGSGQKVTKVCTENSGITCTLCP
NGTYLTGLYNCTNCTQCNDTQITVRNCTSTNNTVCASKNYTSFSIPGVQHHKQRQNHTAH
VTVKQGKSGRHTLAWLSLFIFLVGIILLILYLTAAYRSERCQQCCSIGKIFYRTL
Download sequence
Identical sequences A0A0G2TPP6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]