SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2Y0C8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2Y0C8
Domain Number 1 Region: 311-441
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000458
Family Pseudo ankyrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G2Y0C8
Sequence length 499
Comment (tr|A0A0G2Y0C8|A0A0G2Y0C8_MIMIV) Putative ankyrin repeat protein {ECO:0000313|EMBL:AKI79053.1} OX=212035 OS=Acanthamoeba polyphaga mimivirus (APMV). GN= OC=Viruses; dsDNA viruses, no RNA stage; Mimiviridae; Mimivirus. OH=5757
Sequence
MRPVILPTNNREFTFQKSPWGYYTNMVSLDEIYELANPHTFYMLEKYGLDLGEMSAENRA
LNYSKYYADDYTNSFAHKYFLSRKNVYEDGHSQDIDCEPNQSEDIDCESSRSEKSEDVDY
IIDFNNIYKLKNVTHTPYLGLNLPERLFIITVYRGIFGTKLISQGLNCFSKQEFNRQKGF
IVFDAKNIIKDCYGYFIHSVILPTSHSEFILENRETYYYTNMVIIDKTYELSDPETFRIL
GKYGLDLTVYSAEQRAKNYETSRPMNVLKATSNNHMPSCDFSYVHPTYNHTSTTSVWTNK
NIPLTVDTKVDNVHQFLQNDDFKSAQKLLEDDIVFKKVVDTAIKSNNQKTIKYMIDQQQF
DIDEAIKLALEENKLDIFNMLRLFNFDKIRCLETASILGHLEIVDKMLENDFEKINGDLV
NIVLRNAAEGGKFDIVWYISEKFINFVTKIDIEVAETIVKQRIQHICTFSDDNDIDVSVE
QDMLELFENMKMIVINSKF
Download sequence
Identical sequences A0A0G2Y0C8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]