SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2Y2Q8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2Y2Q8
Domain Number 1 Region: 28-115
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000000889
Family Pseudo ankyrin repeat 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G2Y2Q8
Sequence length 168
Comment (tr|A0A0G2Y2Q8|A0A0G2Y2Q8_MIMIV) Putative ankyrin repeat protein {ECO:0000313|EMBL:AKI78789.1} OX=212035 OS=Acanthamoeba polyphaga mimivirus (APMV). GN= OC=Viruses; dsDNA viruses, no RNA stage; Mimiviridae; Mimivirus. OH=5757
Sequence
MEILTENEEINKLPELMSTDEYQNTAFQQYYFAKITKLGYLEIMKMMIDNGFNIKIFYNI
CMNTACKNGLLDVVKFLIENKYKPDKPCEHYAVTLAFEHNHTDILKYLIDNNYVKYNVRF
SLKSIELVMDRKYYDSLKYISTLSDFNKRKVIMVAKKNQIDWVDIFVA
Download sequence
Identical sequences A0A0G2Y2Q8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]