SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2Y4W5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2Y4W5
Domain Number 1 Region: 200-285
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000248
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G2Y4W5
Sequence length 295
Comment (tr|A0A0G2Y4W5|A0A0G2Y4W5_MIMIV) Uncharacterized protein L772 {ECO:0000313|EMBL:ADO18394.1} KW=Complete proteome OX=212035 OS=Acanthamoeba polyphaga mimivirus (APMV). GN=L772 OC=Viruses; dsDNA viruses, no RNA stage; Mimiviridae; Mimivirus. OH=5757
Sequence
MYYHIDSKSEIDCNDYLFFTDVTKVFSSTTYFANSYLFECLPNESDPEFKITKKSGGHIM
KRFVINNKYPLDNVSTIEFLLDNGSLGVNFIVEWAFSKSNIDILRFFQERNITIPFEPKY
SHATGELFKSKSVTIKYKHSSLLCNVRSTNKYQLIPREINYENLDVHRYVIDNYEYFGTY
LYAYFFYESWIGKNELSLYILQTIKIDVDLILKDVIRVANITYIEMLVGYGAIINNDIFE
SAFKYQDVALVKYLIENYDIDYDLDKLIVESKNIEILQYLLSLGNKTISEYWEVY
Download sequence
Identical sequences A0A0G2Y4W5 A0A0U2L025 A0A165XJV7 A0A1E1EXA8 E3W083 G8EBM7 J3IYV6 Q5UPR8 V5L291 W6GJZ1
YP_003987303.1.55212 YL772_MIMIV gi|311978183|ref|YP_003987303.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]