SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2Y664 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2Y664
Domain Number 1 Region: 134-192,223-272
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000458
Family Pseudo ankyrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G2Y664
Sequence length 313
Comment (tr|A0A0G2Y664|A0A0G2Y664_MIMIV) Uncharacterized protein L696 {ECO:0000313|EMBL:ADO18350.1} KW=Complete proteome OX=212035 OS=Acanthamoeba polyphaga mimivirus (APMV). GN=L696 OC=Viruses; dsDNA viruses, no RNA stage; Mimiviridae; Mimivirus. OH=5757
Sequence
MESIFFMIGFENQYQIGLVESSYDDNPDDYLTTNGLYFTNAKYISDYFNQGTTLFEIKLP
IDDNEFKYIRTGDRWRANRLNLVKSYSLFDSETYNKFGLNITDNKYIMDFASSLGKIDFL
DKTRSLKLLYTNKSLDEASINGHISVLNWWKHSGLKLKYTELSIDGASGRGHIDVLNWWL
NLAIYSKIKFKYTQQAINSASKNGKTDSLEWWKRTRLPLIYTTEAIDAASMKRKINSLDW
WLKSGLQIEYTVSSMDHASWNNHTDVLDWWLKSGLELKYSKNCNNWIDRFGRTDILDWWE
KSGLKIKFKHEIY
Download sequence
Identical sequences A0A0G2Y664 A0A0U2UJ88 A0A140E126 A0A165XJ84 A0A1E1EU86 E3VZS8 Q5UNV9 V5L3W4
YP_003987223.1.55212 YL696_MIMIV gi|311978103|ref|YP_003987223.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]