SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G2ZWB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G2ZWB2
Domain Number 1 Region: 17-83
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000196
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G2ZWB2
Sequence length 85
Comment (tr|A0A0G2ZWB2|A0A0G2ZWB2_9DELT) Uncharacterized protein {ECO:0000313|EMBL:AKJ03029.1} KW=Complete proteome; Reference proteome OX=48 OS=Archangium gephyra. GN=AA314_04655 OC=Cystobacterineae; Archangiaceae; Archangium.
Sequence
MFSVLLTVTRDADRASYSILDSYNLIRSHVPSGIYPFGKTPGGEYLCFDYRDSAQQPRIV
LVTVEMSVLPVANSFQELLEGLHDD
Download sequence
Identical sequences A0A0G2ZWB2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]