SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G3AH09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G3AH09
Domain Number 1 Region: 16-139
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000051
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G3AH09
Sequence length 141
Comment (tr|A0A0G3AH09|A0A0G3AH09_9ACTN) Cell wall assembly protein {ECO:0000313|EMBL:AKJ13128.1} KW=Complete proteome; Reference proteome OX=665007 OS=Streptomyces incarnatus. GN=ABB07_24770 OC=Streptomyces.
Sequence
MGTELLATPPGPVVCRPGAAESALRDCAGALGGPLPEDLADLLRAADGIEGEYGHGLLRP
AERIAAENLALRGDPEFATPYMPFEPLLFFGDAGNGDLFAVLAAIDRPDVFVWNHEDDSR
TWVAPDLATCLRWRLTGRITG
Download sequence
Identical sequences A0A0G3AH09

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]