SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G3DHJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0G3DHJ0
Domain Number - Region: 14-62
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.051
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G3DHJ0
Sequence length 118
Comment (tr|A0A0G3DHJ0|A0A0G3DHJ0_CAMLA) Uncharacterized protein {ECO:0000313|EMBL:AKJ53614.1} KW=Complete proteome OX=201 OS=Campylobacter lari. GN=CD56_04480 OC=Campylobacteraceae; Campylobacter.
Sequence
MLQMMKDFLDQRNLIEKHLEEIKQQLSKMLKEFLSIRNDLSFSNGCNSLEEEIRHYWKIE
AWLDVELKRICIKLIDTRVSYNSFDFENVKVLLAHTLSYEEQKAIIKSLNLETNIKKD
Download sequence
Identical sequences A0A0G3DHJ0 A0A1C2FUI7 B9KC63
306263.Cla_0826 WP_012661535.1.29383 WP_012661535.1.53617 WP_012661535.1.78799 gi|222823829|ref|YP_002575403.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]