SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G3GCE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G3GCE7
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 6.02e-45
Family SMI1/KNR4-like 0.000000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G3GCE7
Sequence length 135
Comment (tr|A0A0G3GCE7|A0A0G3GCE7_9PSED) Cell wall assembly protein {ECO:0000313|EMBL:AKJ96541.1} KW=Complete proteome OX=587753 OS=Pseudomonas chlororaphis. GN=VM99_00140 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MEEIIEQLREANEPVPVPLELPDEDLLVEIEEQLFIDIPFVFREFLLTVSDVVYGSLEPV
TVTDPQSHTYLPEVAANAWDAGVDRSLIPICQDGDDYYCVEEDGTVVLWQAEEELIAEET
WESVWHWARDVWLES
Download sequence
Identical sequences A0A0D0PF40 A0A0G3GCE7 A0A1K1Q6B1
WP_042731763.1.24480 WP_042731763.1.35729 WP_042731763.1.55925 WP_042731763.1.9069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]