SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G3GY91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G3GY91
Domain Number 1 Region: 19-138
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000196
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G3GY91
Sequence length 143
Comment (tr|A0A0G3GY91|A0A0G3GY91_9CORY) SMI1-KNR4 cell-wall {ECO:0000313|EMBL:AKK04523.1} KW=Complete proteome; Reference proteome OX=571915 OS=Corynebacterium mustelae. GN=CMUST_00860 OC=Corynebacterium.
Sequence
MINYEDFVGFDGSDFELGGLSPELLAEGFAFAPDWLPQDFKDFFLDYYSWTVNGTEILPP
APAVVWDNAQMHLFDNFREWYPDREDFYPIAKLNGASYLVFHRKSDGQVECGYYDFTDEA
WYGGGPYESFEKWAYALLENKRD
Download sequence
Identical sequences A0A0G3GY91
WP_047260927.1.89213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]