SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G3H0I6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G3H0I6
Domain Number 1 Region: 11-150
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000916
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G3H0I6
Sequence length 168
Comment (tr|A0A0G3H0I6|A0A0G3H0I6_9CORY) Putative glucan synthasis protein {ECO:0000313|EMBL:AKK06929.1} KW=Complete proteome; Reference proteome OX=571915 OS=Corynebacterium mustelae. GN=CMUST_13175 OC=Corynebacterium.
Sequence
MSHQFSFDDVFIRTGKPCDSVRLAEIERRIGFVLPETYRQIVMGCGGGLIRGGINRIRED
DELGCMVKTLYGNGQPTDGYDDHSLDKLCLPLMETWEMPQWGFFVGEADGEIHTPILLNL
TNPMYPPGALVCVDLEVEEEVLIAESFDALWQVIQRNVEKARADTTGF
Download sequence
Identical sequences A0A0G3H0I6
WP_047262861.1.89213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]