SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G3H111 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G3H111
Domain Number 1 Region: 34-189
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000981
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G3H111
Sequence length 202
Comment (tr|A0A0G3H111|A0A0G3H111_9CORY) Putative glucan synthasis protein {ECO:0000313|EMBL:AKK06450.1} KW=Complete proteome; Reference proteome OX=571915 OS=Corynebacterium mustelae. GN=CMUST_10670 OC=Corynebacterium.
Sequence
MTSYLRTFYETVTTTWPTTPADGQPDYGVELPPRIPTPATEDTIAAVVSRYPLAPPELLC
LLREADGTWHKGDFRGFLVFFREVDGYVESACLNSCQDILDYNETESLEDYYGMDTIRAE
GESLLDPRIDPTIPMNQRMWIGTDRVFYDVYLDFNPAEGGKVGQVVWSVHDADEWRVIAP
SFADYLSTLEAQAATNARNYHP
Download sequence
Identical sequences A0A0G3H111
WP_052844672.1.89213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]