SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G3KF50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G3KF50
Domain Number 1 Region: 6-159
Classification Level Classification E-value
Superfamily Heme iron utilization protein-like 1.44e-45
Family ChuX-like 0.0000695
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G3KF50
Sequence length 164
Comment (tr|A0A0G3KF50|A0A0G3KF50_ECOLX) Putative heme iron utilization protein ChuX {ECO:0000313|EMBL:AKK50351.1} KW=Complete proteome OX=1001989 OS=Escherichia coli PCN033. GN=PPECC33_03838 OC=Enterobacteriaceae; Escherichia.
Sequence
MSHVSLQEFLKTEPDGTLEVVAEQYNTTLLEVVKNLPSSTIVSGDKFDTVWDTVCEWGNV
TTLVHTADVILEFSGELPSGFHRHGYFNLRGKHGMSGHIKAENCTHIALIERKFMGMDTA
SILFFNKEGSAMLKIFLGRDDHRQLLSEQVNAFHALAASLKEHA
Download sequence
Identical sequences A0A0G3KF50 A0A271U9M3 D7ZBX0 V0Y9X8 W1VZJ9
WP_000020039.1.10381 WP_000020039.1.10748 WP_000020039.1.1308 WP_000020039.1.15347 WP_000020039.1.1873 WP_000020039.1.18966 WP_000020039.1.22691 WP_000020039.1.23960 WP_000020039.1.24752 WP_000020039.1.2695 WP_000020039.1.28322 WP_000020039.1.36352 WP_000020039.1.38782 WP_000020039.1.39796 WP_000020039.1.41956 WP_000020039.1.44668 WP_000020039.1.44975 WP_000020039.1.46122 WP_000020039.1.46594 WP_000020039.1.47722 WP_000020039.1.48216 WP_000020039.1.50191 WP_000020039.1.51949 WP_000020039.1.53991 WP_000020039.1.57982 WP_000020039.1.5963 WP_000020039.1.61284 WP_000020039.1.62541 WP_000020039.1.63487 WP_000020039.1.72619 WP_000020039.1.79389 WP_000020039.1.79995 WP_000020039.1.8004 WP_000020039.1.8183 WP_000020039.1.82784 WP_000020039.1.83151 WP_000020039.1.83879 WP_000020039.1.8603 WP_000020039.1.93716 WP_000020039.1.94035 WP_000020039.1.94927 WP_000020039.1.95680 WP_000020039.1.96378 WP_000020039.1.97464 WP_000020039.1.98466 WP_000020039.1.99698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]