SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G3M7Q0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G3M7Q0
Domain Number 1 Region: 24-175
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 8.5e-28
Family SMI1/KNR4-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G3M7Q0
Sequence length 182
Comment (tr|A0A0G3M7Q0|A0A0G3M7Q0_9FLAO) SMI1 / KNR4 family protein {ECO:0000313|EMBL:AKK73067.1} KW=Complete proteome; Reference proteome OX=1324352 OS=Chryseobacterium gallinarum. GN=OK18_10965 OC=Flavobacteriaceae; Chryseobacterium.
Sequence
MKQSIMELQFFKDFDFTDFWYESTYSQRDYIEEFPDDEIITSVEEELGYKLPASYIELMR
IQNGGLVEKDCFPTGEGTSWAHDHVAITGIMGIGRQKTYSICGELGSRFMIEKWGYPDDG
IYICDCPSAGHDMILLDYSKCGKYGEPEVVHVDQEYDYKKTFLAKDFETFIKGLTTDDDF
ED
Download sequence
Identical sequences A0A0G3M7Q0
WP_053328011.1.62176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]