SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G3SDM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G3SDM5
Domain Number 1 Region: 25-146
Classification Level Classification E-value
Superfamily PapD-like 8.9e-37
Family Pilus chaperone 0.0000232
Further Details:      
 
Domain Number 2 Region: 155-241
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 3.92e-19
Family Periplasmic chaperone C-domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G3SDM5
Sequence length 251
Comment (tr|A0A0G3SDM5|A0A0G3SDM5_KLEOX) Molecular chaperone {ECO:0000313|EMBL:AKL36587.1} KW=Complete proteome OX=571 OS=Klebsiella oxytoca. GN=AB185_23000 OC=Enterobacteriaceae; Klebsiella.
Sequence
MKLKLTSFLGILLFTGSQHSAQAALSVERSRVIFNEGEKSVGLSVKNNNTQDPYLAQGWM
ENEKEEKINGPLMVLPPVQRIEPDGRTMIRVQQVADASSLPNDRESVFWLNLREIPPKSD
KPNVLMLAMQTRMKVFWRPKGIKVDPLLDAVPGVETLTLARKGDRYEVNNPTPYHFSFVE
ARDSLNGKALDDFEPVMVSPKDKAALTLPTLRLGNNPTLMFINDYGSARLLPFTCTGTLC
RAGKVALPKEG
Download sequence
Identical sequences A0A0G3SDM5 A0A1F2HL90 A0A1Q8Z4J8
WP_047723935.1.101164 WP_047723935.1.10517 WP_047723935.1.17303 WP_047723935.1.36474 WP_047723935.1.37412 WP_047723935.1.62898 WP_047723935.1.72569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]