SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G3UXA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G3UXA5
Domain Number 1 Region: 75-216
Classification Level Classification E-value
Superfamily Sortase 0.0000000000000053
Family Sortase 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G3UXA5
Sequence length 220
Comment (tr|A0A0G3UXA5|A0A0G3UXA5_9ACTN) Sortase {ECO:0000313|EMBL:AKL70483.1} KW=Complete proteome; Reference proteome OX=465541 OS=Streptomyces sp. Mg1. GN=M444_32450 OC=Streptomyces.
Sequence
MAGAALATLLLAGCGGSDTAAPAAPQGQAPQAAAPAAGGAAPSGKAAASGRPASPGAGAQ
SGSAPAKGTLTRSEPQKISIPSLGLSSSLETLRQNTDGTMQTPKDPGLAGWYEPGPTPGS
QGPAIIAGHVTWNGAAAVFQKLKTMKAGDTIKVTRQDNKTATFTVDRVAEYPKAEFPTLE
VYKNLDYAGLRLVTCGGDFDPKKHYYDSNVVVFARMTGSA
Download sequence
Identical sequences A0A0G3UXA5 A0A1Q5APJ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]