SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G3VLC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G3VLC4
Domain Number 1 Region: 48-232
Classification Level Classification E-value
Superfamily eIF4e-like 7.32e-70
Family Translation initiation factor eIF4e 0.0000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G3VLC4
Sequence length 236
Comment (tr|A0A0G3VLC4|A0A0G3VLC4_9ROSI) Eukaryotic translation initiation factor 4E {ECO:0000313|EMBL:AKL79689.1} OX=262682 OS=Vasconcellea goudotiana. GN=eIF4E OC=Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Vasconcellea.
Sequence
MVVEGTPNPSSTSVAEDKPNSNTTNPNSRPHAHEEDEEPEEGEIVDDDESKGSSAVSLQP
HPLEHPWTFWFDNFSAKSKQATWGSSMRSVYTFRTVEEFWSLYNNIHHPSKLAVGADFYC
FKHKIEPKWEDPVCANGGKWTMTFQRGKSDTCWLYTLLAMIGEQFDHGDELCGVVVNVRG
RQEKIALWTKNAANETAQISIGKQWKEFLDYNDTIGFIFHEDAKKHERGAKNRYII
Download sequence
Identical sequences A0A0G3VJZ9 A0A0G3VLC4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]