SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G3X7S5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G3X7S5
Domain Number 1 Region: 1-123
Classification Level Classification E-value
Superfamily RPA2825-like 6.41e-41
Family RPA2825-like 0.0000544
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G3X7S5
Sequence length 124
Comment (tr|A0A0G3X7S5|A0A0G3X7S5_9SPHN) Uncharacterized protein {ECO:0000313|EMBL:AKM07247.1} KW=Complete proteome; Reference proteome OX=543877 OS=Altererythrobacter marensis. GN=AM2010_1173 OC=Erythrobacteraceae; Altererythrobacter.
Sequence
MGIFSSIKNAIFGSDKKDEKPAAAPAATPAAAPAASQPRAIDEVDVAARLDAMPGADKLN
WRTSIVDLMKLINVDSSYQNRKELAQELGNADYSGSAEDNILLHRQTMRELAKNGGKVPA
EFTD
Download sequence
Identical sequences A0A0G3X7S5
WP_047806283.1.58349 WP_047806283.1.8956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]