SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G3YZG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G3YZG3
Domain Number 1 Region: 12-191
Classification Level Classification E-value
Superfamily MoeA N-terminal region -like 1.03e-30
Family MoeA N-terminal region -like 0.00018
Further Details:      
 
Domain Number 2 Region: 526-669
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.7e-17
Family SMI1/KNR4-like 0.011
Further Details:      
 
Domain Number 3 Region: 191-288,335-375
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 0.000000628
Family MogA-like 0.084
Further Details:      
 
Domain Number 4 Region: 394-463
Classification Level Classification E-value
Superfamily MoeA C-terminal domain-like 0.00000288
Family MoeA C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G3YZG3
Sequence length 673
Comment (tr|A0A0G3YZG3|A0A0G3YZG3_9BURK) Molybdenum cofactor biosynthesis protein MoaA {ECO:0000313|EMBL:AKM42798.1} KW=Complete proteome OX=488447 OS=Burkholderia contaminans. GN=NL30_23275 OC=Burkholderiaceae; Burkholderia; Burkholderia cepacia complex.
Sequence
MNDHENFPFWLDQPYKLCRRVVPGAMQSQTIPVEDALTRVTAADVFAPENVPPVPLAAVE
GYAMRASDTAHAAQGAPVELEFQFSRRALASPAGSPAARAIGAQCAVDVPPYFPLPENAD
AVVPKSDLEVSYRGARSFLLLHAPLSARQHVIAPGSEFRQGSLLLPRGSRITAERQIALT
AAGVRDIEVTKRPRIGVVIVGYEQCATRTVRERWQRPDTSGPYIRAVLQRWGYEVGSVEY
IEPPDMARPPLEVQQNEYAFKKKLAELAQRYDLIVGAGLPAVPPFRNLGLNMPLVYAYDE
TTVDIKQTPADRFNFGRSDNRSPPKKTMVTLTRPDGTQGGTTLLTSYDQATLINLPGHTS
AVAMLMHAIMPRVLDSLEHASTLGPHWESGIVDHGVERDARLNVMRWGNLHRGVDGNLVV
RLLPSEADGLIGGVVRADVLVAIPAGEFPLAAGSSVLFLRLDRDLASEPPRPVAEAAVEA
ATPSPVVDARVTTRDTDDARNIDLRETWRQLEAAFAADASRLPGGLNGPASDDEIAALQT
ALGTQLPDAFVDSLRIHDGQADSGNEFSGSDALLSAHEILAQWRIWKGLVDGGDFDGMES
EPDPGIRDDWYNLKWIPFTHDGSGNHLCIDLDPAEDGFPGQVIRVWHDDARRERIAGSFS
AWLVRVADEGQSS
Download sequence
Identical sequences A0A0G3YZG3
WP_053060268.1.30037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]