SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G3ZAN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G3ZAN8
Domain Number 1 Region: 148-283
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.05e-28
Family Toll/Interleukin receptor TIR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 3-114
Classification Level Classification E-value
Superfamily DEATH domain 2.09e-22
Family DEATH domain, DD 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G3ZAN8
Sequence length 285
Comment (tr|A0A0G3ZAN8|A0A0G3ZAN8_SCOMX) Myeloid differentiation primary response protein MyD88 {ECO:0000256|PIRNR:PIRNR037756} OX=52904 OS=Scophthalmus maximus (Turbot) (Psetta maxima). GN=MyD88 OC=Scophthalmus.
Sequence
MACADSKVDLCTVPLTALNVTVRTRLGLFLNPRTAVASDWKALAEKVDFGYLEIKNFEAR
LNPTAVVLDEWQARSKDATVGKLLGILEKLERNDILEDLRSAIDEDVRRYLERMANLPLQ
VHIVDSCVPRTPERHGLTLEDNLEGAPELFDAFICYCQSDFEFVHEMIRELEQTDYRLKL
CVFDRDVLPGSCVWTITSELIEKRCKRMVVVISDEYLDSDACDFQTKFALSLCPGAQQKR
LIPVKYKLMKKPFPSILRFLTVCDYTRPFTQAWFWGRLAKVLSLP
Download sequence
Identical sequences A0A0G3ZAN8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]