SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4BX76 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4BX76
Domain Number 1 Region: 17-171
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.71e-28
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G4BX76
Sequence length 179
Comment (tr|A0A0G4BX76|A0A0G4BX76_NEIME) SMI1 / KNR4 family protein {ECO:0000313|EMBL:AKM92260.1} KW=Complete proteome OX=935590 OS=Neisseria meningitidis M0579. GN=M0579_00755 OC=Neisseriaceae; Neisseria.
Sequence
MSQVFKDFDLSSVWESDSWADENYKEAPFTPEILAAVESELGYKLPQSFIELMAVQNGGI
FVKNCFPTTQRNSWAKDHVQICEVSGIGFEKEGSLCGETGQKLWMEEWEYPPIGVYFAND
PSGGHAMFALDYRECGKDGEPKVVFVEQESDFEIVELAPDFETFIRSLRHEDEFIDEEI
Download sequence
Identical sequences A0A0E0TNA7 A0A0G4BX76 A0A0H5QFD9 A0A0U1RGQ1 A0A0Y5CRQ9 A1KRR6 C6SDZ8 C6SMZ8 E3D686 I4E381
gi|385342727|ref|YP_005896598.1| gi|121634107|ref|YP_974352.1| gi|385327605|ref|YP_005881908.1| gi|385850499|ref|YP_005897014.1| WP_002221902.1.100113 WP_002221902.1.100130 WP_002221902.1.100206 WP_002221902.1.10070 WP_002221902.1.101472 WP_002221902.1.101880 WP_002221902.1.102138 WP_002221902.1.102147 WP_002221902.1.10247 WP_002221902.1.10289 WP_002221902.1.11246 WP_002221902.1.11276 WP_002221902.1.11354 WP_002221902.1.11579 WP_002221902.1.11628 WP_002221902.1.11670 WP_002221902.1.1184 WP_002221902.1.11853 WP_002221902.1.12105 WP_002221902.1.12740 WP_002221902.1.13538 WP_002221902.1.13577 WP_002221902.1.13760 WP_002221902.1.13938 WP_002221902.1.14004 WP_002221902.1.14015 WP_002221902.1.14530 WP_002221902.1.14606 WP_002221902.1.14800 WP_002221902.1.14890 WP_002221902.1.15470 WP_002221902.1.16257 WP_002221902.1.16393 WP_002221902.1.16566 WP_002221902.1.17523 WP_002221902.1.17793 WP_002221902.1.17811 WP_002221902.1.18517 WP_002221902.1.18905 WP_002221902.1.19059 WP_002221902.1.19474 WP_002221902.1.19488 WP_002221902.1.19810 WP_002221902.1.19909 WP_002221902.1.20071 WP_002221902.1.20103 WP_002221902.1.2102 WP_002221902.1.21463 WP_002221902.1.21959 WP_002221902.1.22322 WP_002221902.1.22987 WP_002221902.1.22995 WP_002221902.1.23356 WP_002221902.1.23507 WP_002221902.1.23799 WP_002221902.1.24135 WP_002221902.1.24298 WP_002221902.1.24622 WP_002221902.1.25457 WP_002221902.1.25496 WP_002221902.1.25760 WP_002221902.1.25893 WP_002221902.1.2595 WP_002221902.1.25993 WP_002221902.1.26128 WP_002221902.1.26268 WP_002221902.1.26495 WP_002221902.1.26810 WP_002221902.1.27066 WP_002221902.1.27180 WP_002221902.1.27436 WP_002221902.1.27519 WP_002221902.1.27579 WP_002221902.1.27855 WP_002221902.1.27878 WP_002221902.1.28090 WP_002221902.1.28559 WP_002221902.1.28626 WP_002221902.1.28641 WP_002221902.1.2875 WP_002221902.1.29030 WP_002221902.1.29189 WP_002221902.1.29411 WP_002221902.1.29437 WP_002221902.1.29467 WP_002221902.1.29595 WP_002221902.1.29968 WP_002221902.1.30990 WP_002221902.1.3102 WP_002221902.1.3148 WP_002221902.1.3158 WP_002221902.1.31811 WP_002221902.1.31993 WP_002221902.1.32542 WP_002221902.1.32549 WP_002221902.1.32665 WP_002221902.1.3272 WP_002221902.1.33274 WP_002221902.1.33744 WP_002221902.1.34468 WP_002221902.1.34570 WP_002221902.1.35315 WP_002221902.1.35813 WP_002221902.1.35931 WP_002221902.1.36245 WP_002221902.1.36415 WP_002221902.1.3663 WP_002221902.1.37727 WP_002221902.1.38045 WP_002221902.1.38201 WP_002221902.1.38726 WP_002221902.1.40262 WP_002221902.1.40352 WP_002221902.1.40364 WP_002221902.1.40940 WP_002221902.1.41013 WP_002221902.1.41015 WP_002221902.1.42319 WP_002221902.1.425 WP_002221902.1.42555 WP_002221902.1.42656 WP_002221902.1.42983 WP_002221902.1.43517 WP_002221902.1.43602 WP_002221902.1.44409 WP_002221902.1.4444 WP_002221902.1.44753 WP_002221902.1.457 WP_002221902.1.46627 WP_002221902.1.46715 WP_002221902.1.46830 WP_002221902.1.4705 WP_002221902.1.47544 WP_002221902.1.47594 WP_002221902.1.47656 WP_002221902.1.4928 WP_002221902.1.49556 WP_002221902.1.49679 WP_002221902.1.49698 WP_002221902.1.49775 WP_002221902.1.50702 WP_002221902.1.5086 WP_002221902.1.51001 WP_002221902.1.51446 WP_002221902.1.52250 WP_002221902.1.52487 WP_002221902.1.52552 WP_002221902.1.52694 WP_002221902.1.53014 WP_002221902.1.53078 WP_002221902.1.53311 WP_002221902.1.53544 WP_002221902.1.54018 WP_002221902.1.54436 WP_002221902.1.54577 WP_002221902.1.54666 WP_002221902.1.55133 WP_002221902.1.55187 WP_002221902.1.55356 WP_002221902.1.55433 WP_002221902.1.55764 WP_002221902.1.56186 WP_002221902.1.56375 WP_002221902.1.56376 WP_002221902.1.56544 WP_002221902.1.56763 WP_002221902.1.5706 WP_002221902.1.57270 WP_002221902.1.57289 WP_002221902.1.57363 WP_002221902.1.57485 WP_002221902.1.57856 WP_002221902.1.58178 WP_002221902.1.58882 WP_002221902.1.59153 WP_002221902.1.59875 WP_002221902.1.60604 WP_002221902.1.6113 WP_002221902.1.6141 WP_002221902.1.61648 WP_002221902.1.62008 WP_002221902.1.62224 WP_002221902.1.6228 WP_002221902.1.62376 WP_002221902.1.62726 WP_002221902.1.63054 WP_002221902.1.64317 WP_002221902.1.64381 WP_002221902.1.64439 WP_002221902.1.64487 WP_002221902.1.65724 WP_002221902.1.65919 WP_002221902.1.66572 WP_002221902.1.66722 WP_002221902.1.66788 WP_002221902.1.67110 WP_002221902.1.67167 WP_002221902.1.67190 WP_002221902.1.67289 WP_002221902.1.6741 WP_002221902.1.67445 WP_002221902.1.67646 WP_002221902.1.67817 WP_002221902.1.68056 WP_002221902.1.69069 WP_002221902.1.69228 WP_002221902.1.69435 WP_002221902.1.70252 WP_002221902.1.70953 WP_002221902.1.71001 WP_002221902.1.71485 WP_002221902.1.71816 WP_002221902.1.72311 WP_002221902.1.72868 WP_002221902.1.73111 WP_002221902.1.73189 WP_002221902.1.73237 WP_002221902.1.73703 WP_002221902.1.74054 WP_002221902.1.74064 WP_002221902.1.74133 WP_002221902.1.74461 WP_002221902.1.75 WP_002221902.1.75106 WP_002221902.1.75171 WP_002221902.1.75299 WP_002221902.1.7571 WP_002221902.1.75815 WP_002221902.1.75822 WP_002221902.1.76226 WP_002221902.1.76694 WP_002221902.1.76702 WP_002221902.1.7676 WP_002221902.1.76823 WP_002221902.1.76960 WP_002221902.1.77619 WP_002221902.1.77679 WP_002221902.1.77907 WP_002221902.1.7807 WP_002221902.1.78497 WP_002221902.1.78846 WP_002221902.1.79147 WP_002221902.1.79388 WP_002221902.1.7942 WP_002221902.1.79912 WP_002221902.1.80076 WP_002221902.1.80233 WP_002221902.1.80391 WP_002221902.1.80447 WP_002221902.1.80791 WP_002221902.1.80823 WP_002221902.1.8150 WP_002221902.1.81706 WP_002221902.1.81937 WP_002221902.1.8305 WP_002221902.1.83351 WP_002221902.1.83633 WP_002221902.1.83835 WP_002221902.1.83971 WP_002221902.1.83990 WP_002221902.1.84565 WP_002221902.1.84701 WP_002221902.1.84759 WP_002221902.1.84834 WP_002221902.1.84840 WP_002221902.1.84962 WP_002221902.1.85208 WP_002221902.1.8529 WP_002221902.1.853 WP_002221902.1.86394 WP_002221902.1.86971 WP_002221902.1.87082 WP_002221902.1.87255 WP_002221902.1.87414 WP_002221902.1.87513 WP_002221902.1.87570 WP_002221902.1.87711 WP_002221902.1.87812 WP_002221902.1.87954 WP_002221902.1.88007 WP_002221902.1.88349 WP_002221902.1.88546 WP_002221902.1.88755 WP_002221902.1.89158 WP_002221902.1.8944 WP_002221902.1.89456 WP_002221902.1.89576 WP_002221902.1.90159 WP_002221902.1.91073 WP_002221902.1.91100 WP_002221902.1.91345 WP_002221902.1.91395 WP_002221902.1.91437 WP_002221902.1.91783 WP_002221902.1.91852 WP_002221902.1.91877 WP_002221902.1.92316 WP_002221902.1.92382 WP_002221902.1.92753 WP_002221902.1.93756 WP_002221902.1.93999 WP_002221902.1.94047 WP_002221902.1.94152 WP_002221902.1.94239 WP_002221902.1.96240 WP_002221902.1.96262 WP_002221902.1.98130 WP_002221902.1.98884 WP_002221902.1.98951 WP_002221902.1.99597 WP_002221902.1.99616 gi|218767075|ref|YP_002341587.1| 122587.NMA0025 272831.NMC0231 gi|385856379|ref|YP_005902891.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]