SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4BZX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0G4BZX6
Domain Number - Region: 19-98
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0863
Family SMI1/KNR4-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G4BZX6
Sequence length 139
Comment (tr|A0A0G4BZX6|A0A0G4BZX6_NEIME) Uncharacterized protein {ECO:0000313|EMBL:AKM93013.1} KW=Complete proteome OX=935590 OS=Neisseria meningitidis M0579. GN=M0579_01551 OC=Neisseriaceae; Neisseria.
Sequence
MYKIKCFYDQFSSGELFNYCQFLDNSSNQKINTRGTVYQYIIYVLTGDLYLQKDIDENLE
FIHQAENNPNEVYSGGGQGFCWDISAEKVVFYHNEFDEEDGWPDLSCSLHTFKTALIAWN
AFLQLPKSIHSVVETVIEE
Download sequence
Identical sequences A0A0E0TPR0 A0A0G4BSP3 A0A0G4BZX6 A0A1D3J0A9 A9M2S4 C6S5R3 E0NAD9 E2PE03 I4E783 J8WAM6
gi|254804526|ref|YP_003082747.1| gi|161869580|ref|YP_001598747.1| gi|385324600|ref|YP_005879039.1| 374833.NMCC_0596 662598.NMO_0530 WP_002214231.1.100005 WP_002214231.1.100113 WP_002214231.1.100130 WP_002214231.1.10028 WP_002214231.1.10070 WP_002214231.1.101655 WP_002214231.1.101951 WP_002214231.1.102060 WP_002214231.1.102147 WP_002214231.1.10247 WP_002214231.1.10413 WP_002214231.1.10552 WP_002214231.1.10661 WP_002214231.1.10682 WP_002214231.1.11104 WP_002214231.1.11132 WP_002214231.1.11354 WP_002214231.1.11384 WP_002214231.1.11579 WP_002214231.1.11628 WP_002214231.1.118 WP_002214231.1.11805 WP_002214231.1.1184 WP_002214231.1.12105 WP_002214231.1.12163 WP_002214231.1.12740 WP_002214231.1.12868 WP_002214231.1.13445 WP_002214231.1.13577 WP_002214231.1.13586 WP_002214231.1.13587 WP_002214231.1.1360 WP_002214231.1.13809 WP_002214231.1.13907 WP_002214231.1.13918 WP_002214231.1.13938 WP_002214231.1.14004 WP_002214231.1.14047 WP_002214231.1.14530 WP_002214231.1.14537 WP_002214231.1.14606 WP_002214231.1.14724 WP_002214231.1.14800 WP_002214231.1.14890 WP_002214231.1.15053 WP_002214231.1.15470 WP_002214231.1.15475 WP_002214231.1.1598 WP_002214231.1.16566 WP_002214231.1.17027 WP_002214231.1.17756 WP_002214231.1.17793 WP_002214231.1.17811 WP_002214231.1.17996 WP_002214231.1.18584 WP_002214231.1.18603 WP_002214231.1.18696 WP_002214231.1.18905 WP_002214231.1.19474 WP_002214231.1.19488 WP_002214231.1.19652 WP_002214231.1.19810 WP_002214231.1.19822 WP_002214231.1.20071 WP_002214231.1.20103 WP_002214231.1.20566 WP_002214231.1.2102 WP_002214231.1.21463 WP_002214231.1.21580 WP_002214231.1.21622 WP_002214231.1.21959 WP_002214231.1.22274 WP_002214231.1.22322 WP_002214231.1.2288 WP_002214231.1.22987 WP_002214231.1.22995 WP_002214231.1.23799 WP_002214231.1.24135 WP_002214231.1.24407 WP_002214231.1.2484 WP_002214231.1.25003 WP_002214231.1.25146 WP_002214231.1.25457 WP_002214231.1.25496 WP_002214231.1.25760 WP_002214231.1.25822 WP_002214231.1.25829 WP_002214231.1.25838 WP_002214231.1.25893 WP_002214231.1.2595 WP_002214231.1.25993 WP_002214231.1.26128 WP_002214231.1.26137 WP_002214231.1.26152 WP_002214231.1.26210 WP_002214231.1.26268 WP_002214231.1.26452 WP_002214231.1.26495 WP_002214231.1.26810 WP_002214231.1.27066 WP_002214231.1.27490 WP_002214231.1.27579 WP_002214231.1.27855 WP_002214231.1.27878 WP_002214231.1.28090 WP_002214231.1.28559 WP_002214231.1.28626 WP_002214231.1.29030 WP_002214231.1.29182 WP_002214231.1.29437 WP_002214231.1.29467 WP_002214231.1.29867 WP_002214231.1.29968 WP_002214231.1.30166 WP_002214231.1.30417 WP_002214231.1.30701 WP_002214231.1.30922 WP_002214231.1.30955 WP_002214231.1.30990 WP_002214231.1.3148 WP_002214231.1.31850 WP_002214231.1.31993 WP_002214231.1.32069 WP_002214231.1.32267 WP_002214231.1.32417 WP_002214231.1.32542 WP_002214231.1.32549 WP_002214231.1.3272 WP_002214231.1.33274 WP_002214231.1.33363 WP_002214231.1.33396 WP_002214231.1.3414 WP_002214231.1.34271 WP_002214231.1.34468 WP_002214231.1.34570 WP_002214231.1.34765 WP_002214231.1.34862 WP_002214231.1.35055 WP_002214231.1.35766 WP_002214231.1.35797 WP_002214231.1.359 WP_002214231.1.36490 WP_002214231.1.36606 WP_002214231.1.3679 WP_002214231.1.37129 WP_002214231.1.38013 WP_002214231.1.38045 WP_002214231.1.38153 WP_002214231.1.38201 WP_002214231.1.38239 WP_002214231.1.38726 WP_002214231.1.38837 WP_002214231.1.38959 WP_002214231.1.39077 WP_002214231.1.39248 WP_002214231.1.39686 WP_002214231.1.40262 WP_002214231.1.40352 WP_002214231.1.40364 WP_002214231.1.40421 WP_002214231.1.40677 WP_002214231.1.40732 WP_002214231.1.40847 WP_002214231.1.40989 WP_002214231.1.41215 WP_002214231.1.41717 WP_002214231.1.42307 WP_002214231.1.42319 WP_002214231.1.42555 WP_002214231.1.42572 WP_002214231.1.42983 WP_002214231.1.43602 WP_002214231.1.43776 WP_002214231.1.43810 WP_002214231.1.4434 WP_002214231.1.44409 WP_002214231.1.4444 WP_002214231.1.44572 WP_002214231.1.44753 WP_002214231.1.4478 WP_002214231.1.4497 WP_002214231.1.45333 WP_002214231.1.45642 WP_002214231.1.457 WP_002214231.1.45832 WP_002214231.1.46359 WP_002214231.1.46428 WP_002214231.1.46523 WP_002214231.1.46627 WP_002214231.1.46715 WP_002214231.1.46748 WP_002214231.1.46830 WP_002214231.1.47277 WP_002214231.1.47544 WP_002214231.1.47594 WP_002214231.1.47656 WP_002214231.1.47808 WP_002214231.1.4784 WP_002214231.1.47876 WP_002214231.1.48085 WP_002214231.1.48136 WP_002214231.1.48453 WP_002214231.1.4928 WP_002214231.1.49387 WP_002214231.1.49556 WP_002214231.1.49679 WP_002214231.1.49698 WP_002214231.1.5069 WP_002214231.1.50702 WP_002214231.1.5086 WP_002214231.1.51001 WP_002214231.1.51761 WP_002214231.1.52250 WP_002214231.1.52487 WP_002214231.1.52552 WP_002214231.1.52694 WP_002214231.1.52785 WP_002214231.1.53078 WP_002214231.1.53311 WP_002214231.1.53501 WP_002214231.1.54031 WP_002214231.1.54176 WP_002214231.1.54250 WP_002214231.1.54456 WP_002214231.1.54707 WP_002214231.1.54816 WP_002214231.1.55031 WP_002214231.1.55133 WP_002214231.1.55176 WP_002214231.1.55187 WP_002214231.1.55433 WP_002214231.1.56375 WP_002214231.1.56376 WP_002214231.1.56859 WP_002214231.1.56890 WP_002214231.1.57008 WP_002214231.1.57238 WP_002214231.1.57270 WP_002214231.1.57363 WP_002214231.1.57375 WP_002214231.1.57387 WP_002214231.1.57485 WP_002214231.1.57626 WP_002214231.1.57856 WP_002214231.1.58501 WP_002214231.1.58882 WP_002214231.1.59122 WP_002214231.1.59153 WP_002214231.1.59180 WP_002214231.1.59188 WP_002214231.1.593 WP_002214231.1.59760 WP_002214231.1.59792 WP_002214231.1.60113 WP_002214231.1.60604 WP_002214231.1.6080 WP_002214231.1.60906 WP_002214231.1.6113 WP_002214231.1.6127 WP_002214231.1.6141 WP_002214231.1.62008 WP_002214231.1.62224 WP_002214231.1.6228 WP_002214231.1.62376 WP_002214231.1.62662 WP_002214231.1.62826 WP_002214231.1.62942 WP_002214231.1.63054 WP_002214231.1.63755 WP_002214231.1.63900 WP_002214231.1.63953 WP_002214231.1.64152 WP_002214231.1.64317 WP_002214231.1.64381 WP_002214231.1.64439 WP_002214231.1.64487 WP_002214231.1.64741 WP_002214231.1.65694 WP_002214231.1.65724 WP_002214231.1.65942 WP_002214231.1.65953 WP_002214231.1.66034 WP_002214231.1.66373 WP_002214231.1.66444 WP_002214231.1.66572 WP_002214231.1.66722 WP_002214231.1.66772 WP_002214231.1.66788 WP_002214231.1.67110 WP_002214231.1.67167 WP_002214231.1.67186 WP_002214231.1.67445 WP_002214231.1.6749 WP_002214231.1.67646 WP_002214231.1.67687 WP_002214231.1.6772 WP_002214231.1.67817 WP_002214231.1.67985 WP_002214231.1.68040 WP_002214231.1.68056 WP_002214231.1.68789 WP_002214231.1.69069 WP_002214231.1.69228 WP_002214231.1.69435 WP_002214231.1.69994 WP_002214231.1.70172 WP_002214231.1.70295 WP_002214231.1.71001 WP_002214231.1.71041 WP_002214231.1.71155 WP_002214231.1.7117 WP_002214231.1.71816 WP_002214231.1.72029 WP_002214231.1.72080 WP_002214231.1.72311 WP_002214231.1.72637 WP_002214231.1.73111 WP_002214231.1.73189 WP_002214231.1.73237 WP_002214231.1.73703 WP_002214231.1.73775 WP_002214231.1.73922 WP_002214231.1.7399 WP_002214231.1.74054 WP_002214231.1.74133 WP_002214231.1.74433 WP_002214231.1.74771 WP_002214231.1.75 WP_002214231.1.75171 WP_002214231.1.75299 WP_002214231.1.75448 WP_002214231.1.75688 WP_002214231.1.7571 WP_002214231.1.75815 WP_002214231.1.75822 WP_002214231.1.75849 WP_002214231.1.76226 WP_002214231.1.76330 WP_002214231.1.76694 WP_002214231.1.76702 WP_002214231.1.7671 WP_002214231.1.76807 WP_002214231.1.76823 WP_002214231.1.76960 WP_002214231.1.77030 WP_002214231.1.77248 WP_002214231.1.773 WP_002214231.1.77619 WP_002214231.1.78092 WP_002214231.1.78133 WP_002214231.1.78231 WP_002214231.1.78497 WP_002214231.1.78846 WP_002214231.1.78905 WP_002214231.1.79147 WP_002214231.1.79388 WP_002214231.1.79489 WP_002214231.1.79912 WP_002214231.1.80233 WP_002214231.1.80447 WP_002214231.1.80791 WP_002214231.1.80823 WP_002214231.1.80981 WP_002214231.1.8150 WP_002214231.1.81608 WP_002214231.1.81696 WP_002214231.1.81706 WP_002214231.1.81937 WP_002214231.1.81964 WP_002214231.1.82858 WP_002214231.1.82998 WP_002214231.1.83048 WP_002214231.1.8305 WP_002214231.1.83346 WP_002214231.1.83351 WP_002214231.1.83633 WP_002214231.1.83707 WP_002214231.1.83835 WP_002214231.1.83954 WP_002214231.1.83971 WP_002214231.1.83990 WP_002214231.1.84443 WP_002214231.1.84492 WP_002214231.1.84565 WP_002214231.1.84701 WP_002214231.1.84759 WP_002214231.1.84840 WP_002214231.1.8494 WP_002214231.1.85200 WP_002214231.1.85208 WP_002214231.1.8529 WP_002214231.1.853 WP_002214231.1.8553 WP_002214231.1.8554 WP_002214231.1.85974 WP_002214231.1.86402 WP_002214231.1.86488 WP_002214231.1.86562 WP_002214231.1.86889 WP_002214231.1.86971 WP_002214231.1.87255 WP_002214231.1.87414 WP_002214231.1.87570 WP_002214231.1.87711 WP_002214231.1.87812 WP_002214231.1.87954 WP_002214231.1.88007 WP_002214231.1.88223 WP_002214231.1.8824 WP_002214231.1.88347 WP_002214231.1.8844 WP_002214231.1.88522 WP_002214231.1.88755 WP_002214231.1.89158 WP_002214231.1.8944 WP_002214231.1.90037 WP_002214231.1.90103 WP_002214231.1.90159 WP_002214231.1.90294 WP_002214231.1.90460 WP_002214231.1.90492 WP_002214231.1.90543 WP_002214231.1.90812 WP_002214231.1.91073 WP_002214231.1.91100 WP_002214231.1.91174 WP_002214231.1.91437 WP_002214231.1.91463 WP_002214231.1.91720 WP_002214231.1.91852 WP_002214231.1.91877 WP_002214231.1.92316 WP_002214231.1.92382 WP_002214231.1.92483 WP_002214231.1.92756 WP_002214231.1.92972 WP_002214231.1.93142 WP_002214231.1.93332 WP_002214231.1.93389 WP_002214231.1.94152 WP_002214231.1.94239 WP_002214231.1.9441 WP_002214231.1.94571 WP_002214231.1.94665 WP_002214231.1.94970 WP_002214231.1.9571 WP_002214231.1.95768 WP_002214231.1.95799 WP_002214231.1.95934 WP_002214231.1.96795 WP_002214231.1.97563 WP_002214231.1.97795 WP_002214231.1.98130 WP_002214231.1.98186 WP_002214231.1.98365 WP_002214231.1.98500 WP_002214231.1.98836 WP_002214231.1.98884 WP_002214231.1.98994 WP_002214231.1.9906 WP_002214231.1.99100 WP_002214231.1.99537 WP_002214231.1.99570 WP_002214231.1.99616 gi|385856804|ref|YP_005903316.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]