SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4CU90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4CU90
Domain Number 1 Region: 50-119
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000222
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G4CU90
Sequence length 127
Comment (tr|A0A0G4CU90|A0A0G4CU90_BACTO) Uncharacterized protein {ECO:0000313|EMBL:BAR81454.1} KW=Complete proteome OX=1442 OS=Bacillus thuringiensis subsp. tolworthi. GN=KNN_00578 OC=Bacillus cereus group.
Sequence
MINHNKIKQLLAHVDRAEDNEIELEYESEPMTIELFNSEEIEEGQLGYSFDEEGQSLVGN
EEGDWKEGWIVIGIDSYLGDPIFVDSNDENCPVYTAMHGEGEWELECIAERIEDIIEKVK
GNVGEIK
Download sequence
Identical sequences A0A0G4CU90 A0A1C9C0R8 A0A1J9WFR9 A0A1M6PTD1 A0A1Q9KTI3 A0A243LA72 A0A2J9B3A4 J8I2Q0
WP_000607083.1.14174 WP_000607083.1.14176 WP_000607083.1.19438 WP_000607083.1.25290 WP_000607083.1.25599 WP_000607083.1.26513 WP_000607083.1.32927 WP_000607083.1.33201 WP_000607083.1.41090 WP_000607083.1.41464 WP_000607083.1.44956 WP_000607083.1.5025 WP_000607083.1.54240 WP_000607083.1.54736 WP_000607083.1.56320 WP_000607083.1.6304 WP_000607083.1.64568 WP_000607083.1.6846 WP_000607083.1.70108 WP_000607083.1.75891 WP_000607083.1.85592 WP_000607083.1.86637 WP_000607083.1.93683 WP_000607083.1.96437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]