SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4CYG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4CYG8
Domain Number 1 Region: 16-167
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.32e-20
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G4CYG8
Sequence length 168
Comment (tr|A0A0G4CYG8|A0A0G4CYG8_BACTO) SMI1 / KNR4 family {ECO:0000313|EMBL:BAR83505.1} KW=Complete proteome OX=1442 OS=Bacillus thuringiensis subsp. tolworthi. GN=KNN_02659 OC=Bacillus cereus group.
Sequence
MGGWNQMSKVQWRSPDEPIIREDVKNVEQELNINFPLDYIECVMNNNGAHVSPEVFEVEG
KRKVFGTLLSYDMEDDENIMEVFDDYKDTLPAELVPFAFDPAGNLICFDYKNDKNNPVVV
FWEHENAGEKEMLLREEGLTEEQVEERARENVFYIADTFTDFLNKLHD
Download sequence
Identical sequences A0A0G4CYG8 J8ICR9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]