SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4D1F4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4D1F4
Domain Number 1 Region: 2-137
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.7e-24
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G4D1F4
Sequence length 143
Comment (tr|A0A0G4D1F4|A0A0G4D1F4_BACTO) SMI1 / KNR4 family {ECO:0000313|EMBL:BAR83738.1} KW=Complete proteome OX=1442 OS=Bacillus thuringiensis subsp. tolworthi. GN=KNN_02892 OC=Bacillus cereus group.
Sequence
MWKDTIHSISSNLSLKNPATKDELTDIQKCLHVELPNDLYQLLQETNGIEGEYGDFIWSA
SKIKTENMSMRNIVDFKDLYMPFDCLLFFADGGNGDLFGYSILNGKVQRDDIYVWNHEND
SRTWVAPSLKTFMEWWESGKMII
Download sequence
Identical sequences A0A0A3VPY8 A0A0D1NV55 A0A0G4D1F4 A0A0W7YIN2 A0A193CUD2 A0A1G1UPA1 A0A1Q9KRA4 A0A243N8S0 B5UMH4 J8I9V0 J8LK29 J8LR11 J8M912 R8EE19
WP_000265342.1.40430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]