SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4D9B3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4D9B3
Domain Number 1 Region: 10-124
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 9.42e-20
Family SMI1/KNR4-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G4D9B3
Sequence length 217
Comment (tr|A0A0G4D9B3|A0A0G4D9B3_BACTO) Uncharacterized protein {ECO:0000313|EMBL:BAR87280.1} KW=Complete proteome OX=1442 OS=Bacillus thuringiensis subsp. tolworthi. GN=KNN_06546 OC=Bacillus cereus group.
Sequence
MINLSNIFGLIKNKPANDIEIQEIEDVMKVELPNVYKGLLKYTNGFSIGGGLIIYGTDDI
IERNETWEVAEYANGYVAIGDDGSGNVFLMSQGADVREVRAVDSGDMNPNHATVVTLDFI
EWVNTGCLNQKIQKIKEEIPDTCNIVLIEIPNGGLKDLVKIKSVLALDISTGELLKGSKN
LPFTLVKGAPYGKAKKIIEKLGSIGLALNTIPMDKNN
Download sequence
Identical sequences A0A0G4D9B3 A0A2C5QKK4 J8HZF9 R8DLT3 R8F2T9 R8FDF7 R8GNN9 R8JVP0
WP_000609229.1.23181 WP_000609229.1.73790 WP_000609229.1.89718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]