SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4DA68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4DA68
Domain Number 1 Region: 2-141
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.22e-24
Family SMI1/KNR4-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G4DA68
Sequence length 144
Comment (tr|A0A0G4DA68|A0A0G4DA68_BACTO) SMI1 / KNR4 family {ECO:0000313|EMBL:BAR87336.1} KW=Complete proteome OX=1442 OS=Bacillus thuringiensis subsp. tolworthi. GN=KNN_06603 OC=Bacillus cereus group.
Sequence
MWKTFISNVSTDFQFKVPATKDEISQIKEKLNVELPNDLSSLLNETNGVLDEYDCLFIWS
IEQILKENLNLRSFNDFKDLYMPFNCLLFFADGGNGDLFGYAILNGVIQKDDVYVWNHEN
DSRTWVAPSLKTFIEWWNNGTITV
Download sequence
Identical sequences A0A0G4DA68 A0A243G225
WP_053512205.1.10688 WP_053512205.1.11584 WP_053512205.1.23181 WP_053512205.1.24680 WP_053512205.1.43914 WP_053512205.1.89718 WP_053512205.1.93683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]