SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4E8Q8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4E8Q8
Domain Number 1 Region: 290-561
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 3.08e-59
Family Guanido kinase catalytic domain 0.00000271
Further Details:      
 
Domain Number 2 Region: 742-998
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 3.36e-59
Family Guanido kinase catalytic domain 0.00000258
Further Details:      
 
Domain Number 3 Region: 184-269
Classification Level Classification E-value
Superfamily Guanido kinase N-terminal domain 0.000000000000157
Family Guanido kinase N-terminal domain 0.00048
Further Details:      
 
Domain Number 4 Region: 657-720
Classification Level Classification E-value
Superfamily Guanido kinase N-terminal domain 0.00000000406
Family Guanido kinase N-terminal domain 0.0013
Further Details:      
 
Domain Number 5 Region: 116-159
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000497
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G4E8Q8
Sequence length 1005
Comment (tr|A0A0G4E8Q8|A0A0G4E8Q8_VITBC) Uncharacterized protein {ECO:0000313|EMBL:CEL92261.1} KW=Complete proteome; Reference proteome OX=1169540 OS=Vitrella brassicaformis (strain CCMP3155). GN=Vbra_10987 OC=Eukaryota; Alveolata; Chromerida; Vitrella.
Sequence
MEVTVTEANSFPPRSYVSIRVGDTRRQAPLKLNEPFRFPSASSNTFKVEVLSMLGGTQLS
TAKLKQKSNVDEIISIPNPAGTGAQSLTLKINAQLTDPAAKKQTERRQSRHQAALNAQKY
LDEHNLQTVLQTMVQQILIDKPKEPLEYMVRYLEKLKVEGAKPGASPSGPIPTGGKSSNP
ALYLDPTLDFPLLETSNTIMAEVLMERQDLYYRYRTTVTNTGFTFDQCIQCGLDCADEGI
LGCVVGDEESVSLFRDFYGLVVAKRHGLGPNGRHPAPSPMLIDPTHIKADSWDPSGNVIL
SARLRINRSIRGFALPPQCTRGERRKVESVVANALCRLTGELKGRYFPLAKMAAADRDDL
VIDKMLFTPPDSQYCQSSRIGRDWPDGRGLYMTDDKSVLVWVNEDDHLRVVALQPNADLK
TLITKTQYLMTELSNALKQDKADFLIDQQFGYITSSPSNWGTGLHVSVVLRVPNLATLLA
FKPLAKTPRATQQPDDKATALLAALGLYISPAPDGRFGDAAADGALDVGNIAKAGMTEDE
ILEVVGEGVKQLIAWEAMLDKEGGSAAVQDEVRKVTQRGFKRPEPKAKAEKVEKVEVPPK
EQPKKDAEAPTEKEEPKELPIEKKETREPDHGPADVAAAPSATAGGQAVRDILKAHPELA
EKYKGVKSRNDFTLEMATKCGIEDASPSSDAAVGCVVGDEESVSLFRDFYGLVVAKRHGL
GPNGRHPTPSPMLIDPTHIKADSWDPSGNVILSARLRINRSIGGFALPPAMDAKERAATE
QLLGDGLSGLTGEVAGQYHRLAEMSPEFRQQFVDEQQLFSSPTSPYFQTTKMGEGWPDGR
GFFLSTSREVLAWVNEDDHLKLMVIKKGGDVKAVVTLMREAVTQLDTYLASKDASFIVDE
QFGHITSCPSMWGTGLKLSLLMKLPHLAALSSFPPSAIAHMGVRVRPEPSGEGLFDVTNA
RAMGASEADIISEVANGVERLIQWEQGMAKGDASKVQQDIQELNG
Download sequence
Identical sequences A0A0G4E8Q8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]