SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4F5D9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4F5D9
Domain Number 1 Region: 325-375,424-503
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000183
Family Regulator of G-protein signaling, RGS 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G4F5D9
Sequence length 521
Comment (tr|A0A0G4F5D9|A0A0G4F5D9_VITBC) Uncharacterized protein {ECO:0000313|EMBL:CEM07552.1} KW=Complete proteome; Reference proteome OX=1169540 OS=Vitrella brassicaformis (strain CCMP3155). GN=Vbra_14470 OC=Eukaryota; Alveolata; Chromerida; Vitrella.
Sequence
MGLSFCQWVSLGTWMLVLLLYLLSAMLFIHRRKQQPVKSRSPILVMFSTLGGFLLATWAI
IEYAIANTPLADDGWVVFTQNTLLTLGHPLFFLPYFLRCYRLAFVFRNVKQRANGERGQR
EREVVSAYQPPAAPLSDGSVATNDGTGHVNTPSHVTEAFLPSFAADDLFARRFRRATERR
LIVILLLSLCLFLALFFMIFLMSTPPTAPVPVPHGHMWADWLWIAVHVIEVVAMLIGVCI
VRRIQDEFSIQWEMVGVLSVSLVAGGVVCALYYDPWGGRRDRTAVEWGIFLAAVIGRSVT
CLGLSAVWPAWQSIRAPPVLTWSSSVSAERLEAVLLDPLCLEFFGRFLRRSPDLDEHALY
FWMGVENLRTSLKPPFPLHSPSYTLPPHPHSTAPYTPSPYSASSSQPASLARLTPPTCGP
ASLEAVQTCEWLWGTYLCEEPTYRLAFAPDGGWVWEDGGGGEGRTYMDFCRNLEAPQRAA
LQYLEHSCFLLFRNSPEYQELQVQINRQNTLRQRLVVADMI
Download sequence
Identical sequences A0A0G4F5D9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]