SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4IGM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4IGM4
Domain Number 1 Region: 250-330
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.75e-17
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.04
Further Details:      
 
Domain Number 2 Region: 125-227
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.000000000000899
Family Poly(A) polymerase, PAP, N-terminal domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G4IGM4
Sequence length 337
Comment (tr|A0A0G4IGM4|A0A0G4IGM4_PLABS) Uncharacterized protein {ECO:0000313|EMBL:CEO94217.1} KW=Complete proteome; Reference proteome OX=37360 OS=Plasmodiophora brassicae (Clubroot disease). GN=PBRA_000002 OC=Plasmodiophoridae; Plasmodiophora.
Sequence
MLPDIPVPATCDDTDDDVASISSAIPSSTPRSTARNVTVANDVPSTEADDPQSSRVNHDD
VVNEAGVLGTRNVRPLSRSRSVVSLWHLQGQVATPEATGIISAQRRSQDLQLAVDLDDFI
AAAKVAREYDARYRQWALHRVTSAVKTMFPMAVVLEVGSAPAGLHLAAPISDVDVVVANV
SDTGAGLVRLFEHLKRDPAFCDVVHIARASTPVVKMTLTGTTLSVDVAWNAPFVAESRAF
VLASSRRHRMFAPLVMYLKYYLYMHGLGTPFYGGVGSFLLYVLVRSHLQVNGEACSVSTG
TCLRSFFAYYGYEFDAFHQCISVVNGGRIFSKVDGCS
Download sequence
Identical sequences A0A0G4IGM4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]