SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4IP35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4IP35
Domain Number 1 Region: 616-738
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.14e-21
Family Regulator of G-protein signaling, RGS 0.0019
Further Details:      
 
Domain Number 2 Region: 480-567
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.1e-21
Family FHA domain 0.0025
Further Details:      
 
Domain Number 3 Region: 183-280
Classification Level Classification E-value
Superfamily PH domain-like 0.00000131
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 4 Region: 325-453
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000011
Family Regulator of G-protein signaling, RGS 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G4IP35
Sequence length 757
Comment (tr|A0A0G4IP35|A0A0G4IP35_PLABS) Uncharacterized protein {ECO:0000313|EMBL:CEO96942.1} KW=Complete proteome; Reference proteome OX=37360 OS=Plasmodiophora brassicae (Clubroot disease). GN=PBRA_005546 OC=Plasmodiophoridae; Plasmodiophora.
Sequence
MAANLKNDRMVVTNMPTKEMGMLYTIKYLPDEALALQRMRLSGADKNTKSDTLFEMDVMA
QNGWRLTPDDVRWAPRTFALDGNFISLREVATPKVSSGIAILFLFAKGNETDVIKILTSD
CIVMLRTRDQNATERLRNVIEAAMKKVVGARLMSQKAHAAEHALHLLQQQAGEQQQLFAA
EPASPDKKGMLEMWNGFQWLPLECTVRQRALWWSVKDSTDIVSFVSLSQAALYLDCEFFK
EGHWAFSIKTPLRVVRFRAVHAISLTEWVLVLKKAIAGDAIPGLQQLDMSAFNGDIVALQ
LELLRQKRETDAMNETLDIVLEMRDACVDLEELIATDDGCEQFANFVGPRLAPNVRCLRM
AFQVFDTSFHKDSEKRAASLDAFQSTYLAKNAPTPLDQLEDIPKDVINEIQKDLKDGPLE
SRTLVRLVDHLVGQLISWFVKFTNSDAYETMIKNGWTKVKVDMTEGSETAVFSLAALDKK
GKRYDLDSDNRWVTIGRDLGKNDIIVSDKKVSRTHAKILYGKHSVQLFDLDSWYGTLVNG
TRCSHAHLKPGDTFTIGPTTFQLQIHEPKKAMHERLITKFKQKLGISKDDDKERDAVKDD
ADAEQHFEADATDQETLGDLLRTTEGFSQFRAYLEKQFASESLLFWRDAQVYRKEFGTSF
TGFNAISIYTTYLQKGAPMEVNLPSSMLRHFRDVFGGIDEGDDDSDKRLTTVLTEDIFDD
ACHELVKLMEVNSFTQFKAYMRAEKQREEEALKGAKK
Download sequence
Identical sequences A0A0G4IP35

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]