SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4IPF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4IPF9
Domain Number 1 Region: 2212-2327
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000131
Family Regulator of G-protein signaling, RGS 0.0077
Further Details:      
 
Domain Number 2 Region: 326-420,723-766,926-996,1218-1237,1356-1401,1498-1666
Classification Level Classification E-value
Superfamily ARM repeat 0.000000012
Family Plakophilin 1 helical region 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G4IPF9
Sequence length 2341
Comment (tr|A0A0G4IPF9|A0A0G4IPF9_PLABS) Uncharacterized protein {ECO:0000313|EMBL:CEO97188.1} KW=Complete proteome; Reference proteome OX=37360 OS=Plasmodiophora brassicae (Clubroot disease). GN=PBRA_000533 OC=Plasmodiophoridae; Plasmodiophora.
Sequence
MSSVSVSQMVDKWEAAAGPASPPPATDEELAPPSMQTAAPSPLDVDSCRQLLRRIAVQAA
ETAQARSRRLDLADGSGSPRVIAVVFEHLLDKYYEGIAKVYAATTGAEPVAFPDAWAGFL
RSLEFEPACFAVLRQLAKVNAEDVVATALRIEFKADHDASPLLREAMSDLTDRVAARVIS
ASLTSTKTMSSHSVGSLLDRAIAAYRKEPTYADDWAKAIGIISVDHLDAVLSAFKTEFQR
HESKSSIGPQAAEALAMMTYVRVVLAGLTEEENRARIVKVLNIHRDIYANKKLKGVPPVS
VAQLTVLDVALRQWGYQSPLAPETLEYLYRRAEKLSHMPQCKAPALKLMATILERSQQDV
YLRQFEPFLRKRVLRHVDNPRKVAHCLRILLRVLRGPYQSPVHYHASDATAANSIGVHPR
SDDSSFHPYACTMREELQSSIVALVTSSLFNKKVLQLAWPRYQMELVEIVMQLACIDVDW
VIERIVLNLLSLKRFPSAHLLAFAVTRRLADHTRPFQKFHRRSVDTGMLRTLTDRIETML
GKALADIPYEQSREPLQIVAIPSSIRAADLQCAAGAAQLDTDYEGSAHGTNLDAYDADGD
SDDRSLDGSPYRSTSYSYSTATFTLRMQSGGEFPFLQTVAPADAQTVGSPGLGMRRRSAP
TIGVAPSMLGRRNSVPALGDTANPTSHGVSPKQANLLQLAESAMKAVATLPSEASCINAE
SATYIPRWILHSSASLALCASSAMQEMCAHCSSEWFPAITESCAGYLANSIERHDISSVT
TLLLQLAANVECWSCKERTESISTSDFKALQTLDATALAYLAHESAVVRRGAYRLLTANQ
HAYEGVGTSGKTWCLGSHIEQNDANLGASAALLLFDYHKSQYPGEVTSPAFTPKLADILL
EDSIGAEAIAAGLASLINNVALNADALPILEQAQSIVEAYLSRLLVGESVNLAETVSLSI
VVLLSIRPKAELALNDTFLNMWKCLLAMDDAPNQNVIDFALCAAHVDHLALLLLTLNQAR
AVHTPSSTKQPTRSRKHQQQQSPDRACVDRAWAHYLVALSTPQRLRHAFAKSPRVRSLFL
DLCRFGITRSAVKWARHPSHLSARAQFLDNVCFALRRRHKYEGVDFSGPFLEADLPEWIQ
EDRALTLVELRAWTECGEVTSPNAEDLLSFIKTQWSMSIEESLAKDKSRRGISDKERAAK
LVESQAHMNKKLPKALLDMRTRAFWCASRLLSLGPTLSGEQVDEGRWSLAPLSFVLTTTV
ASGGWVDWALRGEALGVPILQMFLCFHWHEMRKLLDRLYWASSQKDPLARNLFAGCASQI
VPVLFGLSAAMQRHELEDCVPLTDGDVLEQNQKRPLIHEILAPLLVCAIFHLGSPSRDVS
QTAASMLARLCDTLVPKSSTAEQTKALAMLRTHHPDLQSQIVSIRCKNAMFIARAVADLC
HVDVIALILQEAVLRWGQFHNKQWQQKQWLCEAFEPFFLALPLRQFASIAGDEAAQLLLE
DMVNVTRSLVRDDSPALQALLNIWQSIAGARADPHRNGNVREICEFLLDQSARFLDDERY
SDYIEAARLIAVELHRHSSLAVLDCLLQRFETLDVSLQAQSDPVAALRTPCTLLSAIIGS
RFQTCRARLPAILQHIFVWLPFPGSPCSEVLHDILHFLRHSDPGTLTGLIRPIPCLQGVQ
FQWSGTSLWETQAPNDAIDDAAILKLFDQIAQCTAAIEDSSFIVPVDFVCNVVKRWAGPA
IAREWSQCMLRFASGSARPDLSLTALRTLAIVLPYPDLSTVSTLGRLLTTAITAGNASTV
RQILAIYSRLLTLIVSLQTTYDVFRVLMHLFYQSSALLSWSDGPSDCYFGALRLTQALLS
NPCLGRIIQSFSVDISSKKTSSTHLTVDLLQTQFAQVGAAICPVPFPGLQPILCGAWNQY
SKEPRCLDIVLELLASFWTIPCNSVVDVHGSGNRALVNIVTVIPWLHSQALSPTENSKSS
SYCLRLAQAIDDSHVQWQFAEIADSLRLYAQSPRFQAQALASIASLLSDAFFPRQAKACA
DALRRVMNADAVACLHVAALFLDKSPRVDRTVLLAFEPLLEQAVGLLSRAHGDSKLSDAV
SHLLHVACVVANDVDGNPGSQPQMSTPTHDADTITPAIATPAVAALLSLVADPTGVFGAT
PPYAGQSLPTLSSSEGAAASSPVKLKHTRIVLREEPSEDGTRAEGAAAVQCTLANLLDKP
HLNQQFRKYVAAHGDARGLVFYEAVMTEFCPAVTHTEAARRVAWQIANRFLVDGAPERID
INALTRNEILEQLRNEGQRISPTIFNRAVQDVKNDLVACYTMFCDSPDCERMIRSGQLIA
P
Download sequence
Identical sequences A0A0G4IPF9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]