SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4IR49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4IR49
Domain Number 1 Region: 83-224
Classification Level Classification E-value
Superfamily EF-hand 0.000000000243
Family Calmodulin-like 0.028
Further Details:      
 
Domain Number 2 Region: 16-56
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000654
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G4IR49
Sequence length 249
Comment (tr|A0A0G4IR49|A0A0G4IR49_PLABS) Uncharacterized protein {ECO:0000313|EMBL:CEO97609.1} KW=Complete proteome; Reference proteome OX=37360 OS=Plasmodiophora brassicae (Clubroot disease). GN=PBRA_000954 OC=Plasmodiophoridae; Plasmodiophora.
Sequence
MAASSANANATDKHDGNEYLERSGVGVYIQDALTLLLENRPEHPIMFLVEYFQAADKVSS
PLSRAYRYIRMTPRGRPAYLPNLASAFTVLNTMRSGQRPCGLTGRELTKLLYLLSNEFPV
DVVVPLMRRLRKFDSDLIDIPTFTAAINACLIYEELFDKLEWLFKGCDPQSTGMITRDRF
AEIVQVMELDGDCRKRIASGKRDDPAGKAVLTYRQFLSAMLQLVDLPMTTLETDADPSGQ
QQQQQQQQS
Download sequence
Identical sequences A0A0G4IR49

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]