SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4IRJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4IRJ1
Domain Number 1 Region: 284-412
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000294
Family Regulator of G-protein signaling, RGS 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G4IRJ1
Sequence length 452
Comment (tr|A0A0G4IRJ1|A0A0G4IRJ1_PLABS) Uncharacterized protein {ECO:0000313|EMBL:CEO97711.1} KW=Complete proteome; Reference proteome OX=37360 OS=Plasmodiophora brassicae (Clubroot disease). GN=PBRA_005825 OC=Plasmodiophoridae; Plasmodiophora.
Sequence
MATGTLDLSDTSVLCRVLSSLFAAVYMPASLAWLWQRRTCDPIGQRNPLLVFMGGAATFS
YIIIDFLANAVLIDYIPLFIRFSVLYSLMPLALQALIARGLHLFFIHSYQHELQAQSGTW
FQDHRYLVSTRFALRVIGLVQAVDLIPVFIVMAMDASFLHVDPNTVIFSSHPTPVLIVLI
GNILVTAIHILALARISFLLGPIRDVFGIRQEMSHVNRMGGIGVLAYVIIKFGLPRLSTL
SLDMFVLHAALHALFVLTVCMPLYLSYTPAWKQDRALGQNTTAFERFLMNESVRDAVRPV
MVQTFCLELLLFLQAEQQYRQMFTTVPRADQATIDAAGRRIIKDFIVENASLQVNISDVA
AKPFRPVKRRRISLARPSTVMMTEIMTEFTVETFDRPRKEVVQLIQANIMTRIKSDPALN
RVWEDFLERNRQTLVLRSEANPYPVTVTVLPP
Download sequence
Identical sequences A0A0G4IRJ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]