SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4IYZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4IYZ1
Domain Number 1 Region: 40-134,252-399
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.41e-29
Family Phosphate binding protein-like 0.0016
Further Details:      
 
Domain Number 2 Region: 648-785
Classification Level Classification E-value
Superfamily Globin-like 2.66e-25
Family Globins 0.0024
Further Details:      
 
Domain Number 3 Region: 561-641
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000706
Family Regulator of G-protein signaling, RGS 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G4IYZ1
Sequence length 894
Comment (tr|A0A0G4IYZ1|A0A0G4IYZ1_PLABS) Uncharacterized protein {ECO:0000313|EMBL:CEP00241.1} KW=Complete proteome; Reference proteome OX=37360 OS=Plasmodiophora brassicae (Clubroot disease). GN=PBRA_007975 OC=Plasmodiophoridae; Plasmodiophora.
Sequence
MAMAGILAVLLVGVGTAQATEEWARVRNPFQSPSAAPYATLKIAVKLSPPFVMQGDEAGA
FTGFTIDIWERMKLSDYNEYRVYATDQEVLAAVSSGVADIGMAAISITKEREEMGVDFSH
SFFESGFQVLTHSDMSAVTAVAKALGSAMTLLNVFILLVILELVLCVACVIWIVEVVLCP
DVSKTFVRRRPVKGILDAFRWVLLSLIRRGPSRPNHWVTRVIAVMLNVLSLLVVASLTAY
LTALAMRVSAASTIQGIDDLHTRSVGTTKGSTAEVFLRKQTVYSRIVRYDNTAAMFAGFS
RRDLDAIVYDCNLHMRALELSLMPCLDPILQYHVMNGQYSDRALIVGPIIRPQSYGFATR
EAAGWDRGKLLALRERINRAILLIRDDDSYHYLHQTYFSNIDRSVVRESVATWRTIAWFI
GLSVVVPVSLFAVYHMQKKYKRKRVRDTWFDDELENRLSQANLPVDVLLRVEQQRALLLL
AEAVRGETNKERVSTMQYLSENKFRASLRQQQRRVLDILDNRNPYQRPACDSGRCDMDAG
SMDGDLLSLFLQSKACEAMLLRTAASDYSLERIYFYRHLCLYLSDTDPESCREQENRMLR
LFVEDDAEHEVNISEELREELIEDPSQRDLWVCAHCEVSHMICRGEFLELSMAVTDLVKT
TWLEAIAYTGPNGETMQTIFYTRLFSEMPEARNLFTSGDMSKQEVMFGHIMTDAVTILTN
FEALVKKMAWLGERHRHLGIGHDHFATLGRCLVDTVEEVIGPERFNAETRSAWEMVYDLM
STIMLLAIDKNNMDILGITLRHRDESRAEKPGSRRQSRKRGSCCATSTGTPGDNYVAEET
GSDELRVDVDGQQLALLLVPQRLGRRRRLLLAVLAALLLAVVLIVVVVVVVTQR
Download sequence
Identical sequences A0A0G4IYZ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]