SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4J2S0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4J2S0
Domain Number 1 Region: 135-273
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 7.06e-19
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G4J2S0
Sequence length 295
Comment (tr|A0A0G4J2S0|A0A0G4J2S0_PLABS) Uncharacterized protein {ECO:0000313|EMBL:CEP01812.1} KW=Complete proteome; Reference proteome OX=37360 OS=Plasmodiophora brassicae (Clubroot disease). GN=PBRA_008754 OC=Plasmodiophoridae; Plasmodiophora.
Sequence
MNVFVHSINNELQNMLQLLAGCLSAITDRIRAVAPSATFAVVGSAGKGMNLPLPHSDLDI
LATLTSDELAQFEDNERELVLPLRTNARGMQVLQMPAFPLPNGDATIKVDLVPVSDKSSG
SLLDVVAVRRRPDYHRTRAMVLYLKAFLRVKSSMVDPLLSSPGVGGMSSYLLQVLVIAYV
DSVPDTCANGDLRFCIVGFFGYYGKYFDFANYCIDVTSSDNRFPPKSTFTGPHFTFSSVC
AVDPHDPTNNLGEMTYRISLIRKVFGAAYDDLTLNDVTLLSLFPAPVTLSGNPLF
Download sequence
Identical sequences A0A0G4J2S0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]