SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4J5S9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4J5S9
Domain Number 1 Region: 302-348,381-424,459-491
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.9e-18
Family Regulator of G-protein signaling, RGS 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G4J5S9
Sequence length 496
Comment (tr|A0A0G4J5S9|A0A0G4J5S9_PLABS) Uncharacterized protein {ECO:0000313|EMBL:CEP02935.1} KW=Complete proteome; Reference proteome OX=37360 OS=Plasmodiophora brassicae (Clubroot disease). GN=PBRA_002901 OC=Plasmodiophoridae; Plasmodiophora.
Sequence
MLIHLLLCLGYNMSGRCTLAICRSRTVRYPQTNLLFTVRLALSSHGMDDAYSWVMWTLLC
VQVLLYLPAMILFLARMDRHPIRPRLPVLTAVLITCFVIDDIVQGLCVLDSAALPAGLFA
WVSAPAVTALSSCLFAIGSDCLLLRYAHVFCRYRLTQARILAAATGPESGTVSSVDRWLL
RHPHAGSPHTISVSVAALAVFHAGIALVYLLHPSAWLTAWQTAWSAMVFAGMVVFAYALR
PCHDGFSIRWELINVTRVSFVAVVADIVFDGDGVPITLLVRWVAIQSLIVLTLIMPLVWS
VRQVGPARVTMSEMLETTVCRAAFRLFLASEFCIENLLFLDEVDAFHSRYYRRHKLVHFS
PSLSATPDSDSVLSLSADKPMPDEDRLQVDAQLIYDKFIKRNAPFEVTLSGRLRDRYAMT
FEDSSSAEPQHRFKVSDVVPVGTGMSTPQGSLHMILVVDSNVFREAAREVTSLLENGPWV
HFQQTPIAQELLHMGC
Download sequence
Identical sequences A0A0G4J5S9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]