SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4J5Y6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4J5Y6
Domain Number 1 Region: 57-185
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 5.09e-17
Family Poly(A) polymerase, PAP, N-terminal domain 0.096
Further Details:      
 
Domain Number 2 Region: 177-324
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.00000000804
Family Poly(A) polymerase, PAP, middle domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G4J5Y6
Sequence length 338
Comment (tr|A0A0G4J5Y6|A0A0G4J5Y6_PLABS) Uncharacterized protein {ECO:0000313|EMBL:CEP02666.1} KW=Complete proteome; Reference proteome OX=37360 OS=Plasmodiophora brassicae (Clubroot disease). GN=PBRA_002633 OC=Plasmodiophoridae; Plasmodiophora.
Sequence
MKRGRALPSASSLFSEASRAKRPTWTLLKAKNKQLRGGFADKALLARLWREYRAGCQEVD
RCRQQVVDGVVAALSEDGALHVELFGSNAQGLAIASSDVDLYCALDDCETVRQRILDQCP
AARDIQVISNARIPIVKFVVNDISFDVVCGNRDELEHGRAITKWIRSAMERTAGLADAIR
FMKRWARCRGLLVPRRGTLPSLAILVLAARQKCKAGTSSDEQSVEIIAGAFATIAEGNLL
TNLLYDRDAPSATLVAGAESERIERLQTEHDDFAGTGFGTRMFILDPIIGTINLARFVDD
RTITRIRDAFREAHDHLLQATADDNVFERLARSPSGIE
Download sequence
Identical sequences A0A0G4J5Y6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]