SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4J6Z4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4J6Z4
Domain Number 1 Region: 591-685
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.38e-21
Family FHA domain 0.002
Further Details:      
 
Domain Number 2 Region: 288-375
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000384
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 3 Region: 443-566
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000037
Family Regulator of G-protein signaling, RGS 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G4J6Z4
Sequence length 739
Comment (tr|A0A0G4J6Z4|A0A0G4J6Z4_PLABS) Uncharacterized protein {ECO:0000313|EMBL:CEP03378.1} KW=Complete proteome; Reference proteome OX=37360 OS=Plasmodiophora brassicae (Clubroot disease). GN=PBRA_003138 OC=Plasmodiophoridae; Plasmodiophora.
Sequence
MTTSKPGLFDELPETSFAGDQDADFGVSSNMDVSTASVLERLRYLPYRPDQPGLTQYETV
AGPTFEGYVLLQAASSLLPTKDWRRTFIQIENGYLLSRKLDTDTSYVNRFPISFTMSSLD
VAKEDLVSSFNDVEFTEFDMDVKIASEAINSAIRKRRSEVENHYKEFLENEIAEHVCKVV
TPDNILIVKCESEEQRIQLIEGIERSLRPLLGEELWGQKVAASRKVAPVMKKQLFLQRYR
IEMILKSLSDAGLVNACTSMLASGSKQFQGVVEITEIDVDGGTESANFFLILHDESLYWF
DSSTSKRPKSYLPLSYASVSMDTNLIRNGVWSLTVKTLLRNVSFKAKHAVAMCEWLLAIQ
KTIDACKYDHRKSTQVPSDAGSSLVTPRSPRHKRLSLFSGMLRNVVSDTNSDRVHDDDSL
LKDPEKNDISKVLARVIDLRVSGFTFQELLKSDESSLSVFRHFLDGTCEHTLLDCLLSIH
TCAAKEPVQLAQAELLALRYLGKKSPDHLPHLPPEIGSAVENALASNQGALGINVFDDLK
NWIVPRLETAFTRFKSTNQFRTVVQRLMQVGTDDRDVHGFDNPVSMQLALVLSNDQDKGR
HVVTLDPGKSQVTLGRDESNDIVLNDKHVSRLHIRIAYSNSHAEVFDLGSSTGAIVNGIQ
TVHAPLLPGDTIVIGSTTIKFELRESRMRRGSRLLAGMLKRLGSPRTSSSANQGLPRGNS
SANLVRSNSGGNCQDSEDQ
Download sequence
Identical sequences A0A0G4J6Z4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]