SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4KH19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4KH19
Domain Number 1 Region: 55-86,190-262
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000726
Family Regulator of G-protein signaling, RGS 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G4KH19
Sequence length 493
Comment (tr|A0A0G4KH19|A0A0G4KH19_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:CRJ90037.1} KW=Complete proteome; Reference proteome OX=100787 OS=Verticillium longisporum. GN=BN1708_009320 OC=Plectosphaerellaceae; Verticillium.
Sequence
MSLKFYKTPKEDHPWRSPVQDDTCSRYAAAAARAKKWLPPTLRFEQVVRNHTMPPCSLND
FMDYLVYVEQNAEPLQFFLWYCGYVQSWMELDAHERALVPRWDPADAEARAAAKADANRK
RRGPRVAMSGRYRRARNASKVSNILEILDADGEEKEEKELLGSASPASSRPSRNFSRPSA
PPGTVEAWISPPHQPFRDEVTQILNHYVDPSAPRSLGLTLRDRAAIADATAHTTHPTSLL
PAFEKADAILRGHLHPNFIRSSIANTNSPTTYVLRVSAWLLLMLGFSAAAALNLCTARFA
LSRYWRIAPFALWAPGFAILVAAADGLSISLYFAGRRQLRPWEAQPTPAELEDASWRGRR
AARRATAAASPAGDDPLRKPSLRTFGPGNGFRSEWWVRAYAKTGLWWRIFETTRPVGEGE
VRVLQDGVVITAFIWAFVLAGGLAAGSVFVPAFDPWTMKQIVEASTEIPTSLLHQRGTWK
LYLMLRTEPRCNG
Download sequence
Identical sequences A0A0G4KH19

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]