SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4L558 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4L558
Domain Number 1 Region: 48-92,206-278
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000000437
Family Regulator of G-protein signaling, RGS 0.0072
Further Details:      
 
Domain Number 2 Region: 535-566,680-753
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000000339
Family Regulator of G-protein signaling, RGS 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G4L558
Sequence length 919
Comment (tr|A0A0G4L558|A0A0G4L558_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:CRK17162.1} KW=Complete proteome OX=100787 OS=Verticillium longisporum. GN=BN1723_002331 OC=Plectosphaerellaceae; Verticillium.
Sequence
MGLLSLTYRRPQYVDDSSFRDSASSLNEKSNSSLRSGRSGTTGIPESLAFDRIINGGTCP
PCTVRDFMNYLIYIEHSAENLQFFLWIKDYEKRFANAKPSELALAPEWTQEMEDETIANL
RKEKAGAFRQAKPGHEIFKGTDFEKKANGPPNPHSAEPNPFSTPPRTPAGQNDVDSLFSS
SQGMSVVGTFRSQATEAFANAGAKQPFTIQPFREEVDRIVATYIMEGAPRQLNVSDRERN
AVLHGLAYTTHPSALRIIFKSIDHSLRHQAHPNFIRWSICNGNPARVFFARFLGVFLIAA
SLVAAIILTLSSAPRGYRAIPAVGFVLGVSTLVAAWKGMCVVLHGMHHRHVRPWELFIDN
EGECDLSKTSFESFGSGNSYETEPWVVKYEKRNTVRKVFDREVWIQEPALRQIQDTIFVQ
AMLCALLAAGVLTAIFVALAITSLCADPLHTRDSASSRPPAAAVTRAITTMSPVIVDDGS
AIEDVASDQHQATQTSTTDAPITGRPRTMTTTEEIDSTIIRPGSVRINVKGAFIPCTVRD
FMNYLIYIEHSAENLQFFLWIKDYEKRFANAKPSELALAPEWTQEMEDETIANLRKEKAG
AFRQAKPGHEIFKGTDFEKKANGAPNPHAAEPNPFSTPPRTPAGQNDADSLFSSSQGMSV
IGTFRSQATEAFANAGAKQPFTIQPFREEIDRIVATYIMEGAPRQLNVSDRERNAVLHGL
AYTTHPSALRIIFKSIDHSLRHQAHPNFIRWSICNGNPARVFFARFLGIFLIAASLVAAI
ILTLSSAPRGYRAIPAVGFVLGVSTLVAAWKGMCVVLHGMHHRHVRPWELFIDNEGECDL
SKTSFESFGSGNSYETEPWVVKYEKRNTVRKVFDRELWIQEPALRQIQDTIFVQAMLCAL
LAAGVLTAIFVAVPGGKLM
Download sequence
Identical sequences A0A0G4L558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]