SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4LIW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4LIW8
Domain Number 1 Region: 518-668
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.27e-28
Family Regulator of G-protein signaling, RGS 0.00097
Further Details:      
 
Domain Number 2 Region: 1421-1571
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.27e-28
Family Regulator of G-protein signaling, RGS 0.00097
Further Details:      
 
Domain Number 3 Region: 380-493
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.8e-26
Family DEP domain 0.0073
Further Details:      
 
Domain Number 4 Region: 1283-1396
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.01e-25
Family DEP domain 0.0076
Further Details:      
 
Domain Number 5 Region: 1122-1234
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000158
Family PadR-like 0.044
Further Details:      
 
Domain Number 6 Region: 234-341
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000136
Family PadR-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G4LIW8
Sequence length 2019
Comment (tr|A0A0G4LIW8|A0A0G4LIW8_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:CRK21844.1} KW=Complete proteome; Reference proteome OX=100787 OS=Verticillium longisporum. GN=BN1708_003459 OC=Plectosphaerellaceae; Verticillium.
Sequence
MAAISYSNRSSIRDQLPQSTSTSRSSTRVASRRSSLASPSAPSSPAVDPFSHEGQAASTS
TGYRQIGHFSSPSTSKIQRSGGLLGLAAAAIDKTQSALSTLQSQSQSQPDYSIRQRPSNS
ALGRVASSADSAFSPTDLDKNAHARYRRSNNHSPASSSTGTFAAEGKHPSQVSLANEVPS
SPYSDTDPNRPLPIRIPAVENKMHQTSSRLLRMTDDDKPFTKDFKDLFATLVVSLLPLSA
HRVRLTRVENTFLSEDAINNLGSLKFSQSNRMPDPKDTSRIVTTTTTTTFSMAKDMARSI
CQRFLEARFIESADGKYQQVYNMKGSVWQLTPKGKQTSDLIGSTLSQLVILERDGQTDKL
ITDRGTVEVVFRRFVGTHGPNIKSSVTSADSDSLSDYRDGLTGVKMASERKINGKTYRDT
FTGKGATDWLMDCCTTVDRREAVDIATLFVQFDLMEAIVQDRAHMSQYAGHNVFQPTKNA
IYQLTAKGKDLINNVGSRGRASESEGTNPSRNAIARDSNTQRLDKILNDAALRLLFRENL
RETHCEENLSFYLDVDDFVRSCKVAIRSAQKNPNSTSMDGIKEIMAQAYGIYNAFLAPGS
PCELNIDHQLRNNLATRMTKAVGQDVAMIDTLQEVTALFEDAQNAVFKLMASDSVPKFLR
SPKYEHTLKHYDFDSLTNVRPGGLERSQTFLFDLLQPAPVILLDPQQPPSHPTPNRTALF
SNVPPAQLVKMYTNTVLSTLAAAGMASAYIPARRQETNGTVTTTTVTEVVSELATWCPEP
TNYVTWEEKVYTVEGPTWFTITDCPCTVTRTTECAGKPTPHPWTPEHPGHGGHGECHDGY
YPDGKPCHDNMKPVHPEYPAGPGKYPGQCHGGKYPDGNTCHGEPRYPDGCVDSKYPDGRE
CHPLYPVYPADCHEGKVASRRSSLASPSAPSSPAVDPFSHEGQAASTSTGYRQIGHFSSP
STSKIQRSGGLLGLAAAAIDKTQSALSTLQSQSQSQPDYSIRQRPSNSALGRVASSADSA
FSPTDLDKNAHARYRRSNNHSPASSSTGTFAAEGKHPSQVSLANEVPSSPYSDTDPNRPL
PIRIPAVENKMHQTSSRLLRMTDDDKPFTKDFKDLFATLVVSLLPLSAHRVRLTRVENTF
LSEDAINNLGSLKFSQSNRMPDPKDTSRIVTTTTTTTFSMAKDMARSICQRFLEARFIES
ADGKYQQVYNMKGSVWQLTPKGVTVLDRFCSRNGIQQKQTSDLIGSTLSQLVILERDGQT
DKLITDRGTVEVVFRRFVGTHGPNIKSSVTSADSDSLSDYRDGLTGVKMASERKINGKTY
RDTFTGKGATDWLMDCCTTVDRREAVDIATLFVQCDLMESIVQDRAHMSQYAGHNVFQPT
KNAIYQLTAKGKDLINNVGSRGRASESEGTNPSRNAIARDSNTQRLDKILNDAALRLLFR
ENLRETHCEENLSFYLDVDDFVRSCKVAIRSAQKNPNSTSMDGIKEIMAQAYGIYNAFLA
PGSPCELNIDHQLRNNLATRMTKAVGQDVAMIDTLQEVTALFEDAQNAVFKLMASDSVPK
FLRSPKYEHTLKHYDFDSLTNIRPGLERSQTLFFNAPVQLVKMYTNTVLSTLAAAGMASA
YIPARRQETNGTVTTTTVTEVVSELATWCPEPTNYVTWEEKVYTVEGPTWFTITDCPCTV
TRTTECAGKPTPHPWTPEHPGHGGHGDHGECHDGHYPDGKPCHDGHYPHGECHDGHYPDG
QPCHGHVKPVHPHYPGHHEECHGGKYPDGSPCHDGHYPHGEYHDGHYPDGKPCHDNMKPV
HPEYPAGPGKYPGQCHGGKYPDGNTCHGEPRYPDGCVDSKYPDGRECHPLYPVYPADCHE
GKYADGKECHSAYPEYPAECKYALYPDGKPCEPIHPEYPAECHGGKYSDGRDCLPVYPNV
PPHGPEVPEKPVCDGPDCGKPQPPPYNNKPVCDGPHCENDGNKPACYGPACEASATLPHV
PYPTGDHVEVNGAASLQQGLLCAGMVIAAVATVFGAAGW
Download sequence
Identical sequences A0A0G4LIW8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]