SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4LNQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4LNQ5
Domain Number 1 Region: 43-115
Classification Level Classification E-value
Superfamily PAP/Archaeal CCA-adding enzyme, C-terminal domain 4.9e-22
Family Poly(A) polymerase, PAP, C-terminal domain 0.0012
Further Details:      
 
Domain Number 2 Region: 105-169
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000000000142
Family FHA domain 0.0054
Further Details:      
 
Domain Number 3 Region: 1-40
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.00000942
Family Poly(A) polymerase, PAP, middle domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G4LNQ5
Sequence length 283
Comment (tr|A0A0G4LNQ5|A0A0G4LNQ5_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:CRK23672.1} KW=Complete proteome OX=100787 OS=Verticillium longisporum. GN=BN1723_018091 OC=Plectosphaerellaceae; Verticillium.
Sequence
MCATFNITKSAMTVIQRELQRGCEITDNVMLSKRPWGDLFIKHTFFTSGYKYYISVVTTS
TTKEAHKIWSGYVESKVRVLVQGLEQHQSIAIAHAFNKGYDRRHVKLVSRRHARIFFNSE
DESWFLEVIGRNGVKANNSPLKQGTSRPLQSGEVLDVGGTEMMFVLPTEISTLHIHPIYL
KRLGIPKQDVTSPIPPPSAAGPSDEPPSSQPASSGRSQPFRQPIAPAPPDYKRPGTPPSA
RSKVLSAQHKSPGYSSSGTLLLSANDVDLSQDDNRHIKPQFSY
Download sequence
Identical sequences A0A0G4LNQ5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]