SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4PCP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4PCP7
Domain Number 1 Region: 70-172
Classification Level Classification E-value
Superfamily GINS helical bundle-like 7.85e-30
Family PSF3 C-terminal domain-like 0.0033
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily PriA/YqbF domain 3.6e-18
Family PSF3 N-terminal domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G4PCP7
Sequence length 193
Comment (tr|A0A0G4PCP7|A0A0G4PCP7_PENCA) GINS complex, subunit Psf3 {ECO:0000313|EMBL:CRL24072.1} KW=Complete proteome; Reference proteome OX=1429867 OS=Penicillium camemberti FM 013. GN=PCAMFM013_S011g000066 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MSYYDIDSILTDAQKLPCTFELEVPGLGILEGNAGEDIKAGTRIDLPLWLGEMLSIGARL
GTSRLVTLDMPEALSERVMNALKADPRTLDLRALAPHFYNLSERILELFEEEEMVDVLGD
AFKKRAAEIADHAHNSRGAVGGGVDFLRGLDETERQLFRAAHDRAKDMRIWSGEAKREVQ
ILRSTHGDGHVET
Download sequence
Identical sequences A0A0G4PCP7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]