SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4PF59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4PF59
Domain Number 1 Region: 1598-1695,1754-1942
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.58e-47
Family Ankyrin repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 792-1123
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.18e-42
Family Ankyrin repeat 0.0001
Further Details:      
 
Domain Number 3 Region: 1858-2065,2094-2157
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.29e-39
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 4 Region: 2068-2312
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.37e-34
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 5 Region: 1379-1691
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.82e-21
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 275-358,413-474
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000066
Family Extended AAA-ATPase domain 0.08
Further Details:      
 
Domain Number 7 Region: 1092-1124,1215-1300
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000314
Family Pseudo ankyrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0G4PF59
Sequence length 2640
Comment (tr|A0A0G4PF59|A0A0G4PF59_PENCA) Ankyrin repeat-containing domain {ECO:0000313|EMBL:CRL24936.1} KW=Complete proteome; Reference proteome OX=1429867 OS=Penicillium camemberti FM 013. GN=PCAMFM013_S013g000179 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MSQANCSAGATLWQKALNELGPDSRASLEGIINDPSTDVVTDVLQEAKKKKALCLRKRWK
IEFRGETIVLRDLFDKIIAWADQFKALIDVVVQYDPTAASLPWAGVRFLLHVAISDRQCF
ESTVCGLEFVSLLIARYAGLEALYLQKAPQRPSSPVKSQLENGLIRVYSDILVFLADGIR
YFGQPTPVRMVKSIFRSYQDDRIDRMVKGDEEVIKLAQVVDSQLLQQTSVQVSDIRSIVE
TLQRPIQRLVDESAIYAKTLEQDKFLKILQWLSSVPYSQHHKRHSDESLAGLSQWIFRHP
QYMTWKGSSSSSILLLHGIPGSGKTHIVTAIIENFLADRSLNPLCAPIAYFYCGDSRFGR
EWTDPDELMRSITRQFAIVDKEKLKIHESVSLEYARREAEAKLDGFEVPKLRSAECADLI
LGILGANPAVIIIDGVDEIREDQRHDLLHALTRIRDESASVVNIFLSSRDNNNIFSGLPD
ASKVRVQETDSRQDMEKYVRHCVSTAIASRNLLNGCVPDDLELQLTEFLIKKAGEMFLWV
NLQMERFCKLRSAKSVGDKIQDPSQNSTTIDNLYSGILENLEQTDPVAYETATNTFSWML
CMQEPLTCTAILEAVSSGGPNKHDLNLSELLHICSNLIVLDSQLNTLRFAHVSFKEFLET
KPRFDSTIVHGIAALRCLESCINCLPIDVDCVSQPANSYILYAVMYWPNHYVRSIQPHDD
LSKKLKEFIFGDEGFPFGLWSEAANEVAKRIPNGHSLKKDLNSVASDTQTPFFTVCIYGL
MGIFHEVTGASDFDIDSTNLLGQTGLYLAAACGHRELVSLIMDLGGNPSISKGKHKDPLL
AACANGHFSVVEFLVTQEGRSILLIDLESALRVSFPTGNEQITKLLLNTYLNLGENQDST
DRSWILEAAAQTGFVEVMEILTKDSSKSTASKSSLKIINFALRKGNIPFIKRYLEKQQLP
EDALATAALFGHTEVINMCIDTGCSIEAENSFGTPLRCASLMGHEAAVRTLLSHGADVNA
SKSLGDALQTAAMKGHLSITNLLIQHGSRLDNSGGFFGNALQAAAYRGHRDVAETLLNAG
ALIDVPYSKNGRYKDAFHAAAESGKDKVIDLFISKGYHLPGRDTRHAHYLEDLGGPFKDL
LEEASPTRNRLPREFAKESDEESNYETKCMPLIAHVADFQDILHFSTNSVVTPVDETHPV
YSVNRSQRDGGDLDSSYYALEVAASRGYLATAQRILAMREQLGLRPYHLGRALWAASKHG
DPDLVQAIVSVEVDFCPFISGSLERAARHGHLEAIEILLRYDKSRRLLGKRAAEPSSASV
WWCREDLEENQARRRHEYPDYSFGSENVLCLVFPSCRGDQLSTMLRGFQLADESETEDLT
KMALREAIRFNSMSIVDFLLKSEVHLTAKFLSQLMKTAAANGCTPALTLLVSRDPTGEVL
VANNDVCITSAICGSHSDTVQFLIDNGTYGCDTSILEKGFVHAAQMGDIGILKSLSSVML
GSQSYCNILAQSLNAACWAGRRNTAEWLIHAGAEVNSVVDGIPSLETPTKGCRRRQRQVS
RGNKWTWPRKPLISCLQPLDRRLVNFNLERDEWENLETARSDRESIIGLLLDHGANVNQV
GGCMRTALHIAVEHCSEQVVRALISHGADVNNNILWHGSPLQCAVRRETSPLPVVSALIE
AGAIINFQDNVERYCVVLDESLKHFGPREGGDYGFAELKSMDQVFSDGPGAVIKRLLVSE
TELRAIDYRFSHLLQMLAARGDLEFIRLLIERGVDVNACGYYYGCALQAAARYSHLECVQ
LLLEAGSKVNTIEGEYNTPLQAAIVGGHEGVIRELILRGADVNLTFKRRFKDTPKSSPLQ
LSVRSRNQAVTRLLLENGADPNKGPKVLHLAVDSQDLETVRMLLDAGADVNFQDQIIPSP
LITACGLGNMKIATLLIERGANMQAEGIKVDEYGWRDNTTSPNNHQASALHAACAGGNYE
IARMLLLHGTNPNQSFGGCATPIAVAASNGCSRTVELLLEFGAMVYDPPDVPNALVEAVT
GKNPREIIGLLLRQLLNSPALIPACEEALQEVLAHGSESILLFLIQKVPESLRAFAVACR
FGSKRAVSVILSHGVDVNSDLGSGDQALHLAAFHHQIDVVSFLIEKGADASITGSAYGSP
ISAVLEGLLAVVRSHDSAKDQILPKSTWERSPLPEEIALCKGIVSILREAGADINSTNRP
LGPPLHIAAFIGETSLVEFLIDQGASIDATAGHFGSALIAAMIDDRHATLDFLLLRGINV
NACSEEFGTALHYACGYKNSKTVQTLLNHGSDPTLNVPRLESPLTAVLNRVTEEDSDGVL
KVLLQYAPGLQIRDADLVLAAQVPSDHLCSSKKTALERLLEHSPELPVTQGVIAAIVPLD
YPRDKVLKTVLQRANGVEITTDILKSVRKLQTLEVLFQFQPQCEISPEVFAAFARVDREG
PYLLKASLDRYPQATLTPGTVLSFLEQCEGYRRCNSSLVDILQTMLDRAPDMAITDNMLM
AVAYPDQLRLLLSRYRNNLVPDNVLASVFSDSYKKDGIQLLKDPSFSLPRDLPSILIAEL
RTGDRTRELGVFAEVFHRYGKSVEFTHENRRDIDELLQLQSENDLKRLLLTLEKKDCGEI
Download sequence
Identical sequences A0A0G4PF59

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]