SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4PL55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4PL55
Domain Number 1 Region: 55-193
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.15e-23
Family Regulator of G-protein signaling, RGS 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0G4PL55
Sequence length 356
Comment (tr|A0A0G4PL55|A0A0G4PL55_PENCA) Regulator of G protein signalling superfamily {ECO:0000313|EMBL:CRL27162.1} KW=Complete proteome; Reference proteome OX=1429867 OS=Penicillium camemberti FM 013. GN=PCAMFM013_S021g000077 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MLKKKTLAPSLFFRNHTPTATPELSPTSSDSDSEEDMESSGSRPVSLAISSGAFSMRPTL
NEVLANIAPPPYTLSAFMAYLSQNHCLETLEFTMEANRYRDSYYALAERIGPAAMESECP
ETQHLRMLWKRLLTAYIFPGSPREINLSSEVRDALLQYKNVPAPPVPETLDSAVKRIHDL
MEESIFLPFVNSHTTSPSMGPSDPFMGPDDFMSLSSTSLDEHPMKKVRSRVSKRISPQSS
SKDLSATGHNRSTMSLGAVHALGKRTSGALVNTSGESAYLSLTDDSASPQSSPTAEEPMT
PPTTPPASEPHLPIHSPRLRTENPWKKMGMKLGFKKRSTGGSNGSSRDPKILGLED
Download sequence
Identical sequences A0A0G4PL55

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]