SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0G4PQP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0G4PQP5
Domain Number 1 Region: 319-484
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000145
Family Extended AAA-ATPase domain 0.058
Further Details:      
 
Domain Number 2 Region: 1143-1157,1226-1315
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000942
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0G4PQP5
Sequence length 1491
Comment (tr|A0A0G4PQP5|A0A0G4PQP5_PENCA) Str. FM013 {ECO:0000313|EMBL:CRL28473.1} KW=Complete proteome; Reference proteome OX=1429867 OS=Penicillium camemberti FM 013. GN=PCAMFM013_S028g000026 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MHNGTQSLWRTATAKLDKVDQKLLDFDSDDGIKRTRENELDILESLEQTTREAYDTCIHK
RWQITIPGKGKKIIIRDLLSKVAHWIELFKSVGDQIVQYDPGHAALPWAGARFLLQIAIN
DFGKFDFVVQGAERIARMTARYRIIEQIYAQKGSAASEQLEEAVLGVYGSILKYLVEAKR
YFEHKTGVRLLKSGLLGQNDFQELLEKMEADERLVDRCASLVQGEMNNDIASHLATLSLE
METFHSLRDTLGRMAQPISQVSFHLNKFEDHLDSIQRRQMLDWLSTQPYLDHHTTIKFRV
LDGTCQWVLQHPCFTEWKCESTNSLLWLHGAQGAGKSCLASVVIDDATNVSSRIENFAHA
YFYCSRNTAEPRRGNAQSILGCIARQLSSPSSNQPLAPPAISLYRKIHLADGSTRAPSLW
ECRDLIIDLTEAHSRTTIVIDALDECGREERAELVEALEYIIDNSASLVKVFVTSREEGD
LRLSIQAHSGVQVTWIENGSDIEKFVNFETDRLVAKNQLLASIRVKATKEDLKALIKEDT
IYKANGMFRWAQLQLQSLRWIRTERDIRLAMSTIPRPLSELYEDLYIKALESTEETDRAL
FRNTLKWMLCTTRVFGWEDFSLAITAFVDIEVYEIDEDFILDLLSNFVISQTTQDGNRTF
RFAHLSVREFLETKPEYSMESSNTLAAEVCLLKLLGASGSPSAEHFLGRLGLSDKDTITL
SEIDSYRKGIHDYSLRNWNVHCVRAGETNRSDEEQHLFHLLRYFLFDDSDSDCPLKCWVH
SRQRRKMEGMRGSHLLQLLQNYNHSRDRGVLLSCVFGFGEVLRTNHYHELGDDVKEACIL
AAVTHSQYYIWEYLMGKTKSRLLQKRVLNVLVENHHIEPLRLFLTLIEPDLITVPVIMDA
NRADKEIIELLLDHNENLHITTELIEESMSSYTAIEPILSRAPDILITSEILKNAIADIP
IEHLTEILDKNGGSIITCEVIASAAYYGSRDGMRAKTELLLERAGQLKGTERAMMQAVSS
RENSDVIGILLNHGWPVTENVMVKAATRGKVAPFEVMLKAGGPITSKVIVGGARNTSDGA
RMVKLLLSLMNRPLDDELWVQMMLQCAHNTWENPETLQVLLEMKPGLKVSEEVLIACTEN
SIKGNIILDVILEDNREMQVTDAVIVHALKDLDYDETISKLLDRHGSTIISSQMLLGAAQ
NRRFADEMTKLLLQRTATIERPSSVVVDAAIRNGYSGYKILQMLESRFGQLDLCEANVKT
AAESGNHAMLTLVLDRCSTTEATPSVLLAAATKGSLEVMKHLLKLNNAVVTQDILIGASG
NSGCSIDMLRVLWKFAPHIKVRPEMFLNAAYATDVEFLFSRVKDSQLCQDILDAVMTRKE
TPNDWPDWVSVPTLNLILESEFEIAVTDGLIVDALNAGRGWLLKTLFAHRKDIEVSQDMV
NTAVKLAVELEDYRPLQVLVKYGNSRELKLHDARVILDNFLWGYSKESRRR
Download sequence
Identical sequences A0A0G4PQP5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]